DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ftz-f1 and nhr-3

DIOPT Version :9

Sequence 1:NP_524143.2 Gene:ftz-f1 / 40045 FlyBaseID:FBgn0001078 Length:1027 Species:Drosophila melanogaster
Sequence 2:NP_510423.1 Gene:nhr-3 / 181551 WormBaseID:WBGene00003602 Length:463 Species:Caenorhabditis elegans


Alignment Length:242 Identity:79/242 - (32%)
Similarity:108/242 - (44%) Gaps:26/242 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   483 PMGGTSATPGHGGEVIDFKHLFEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVAE 547
            |..|..:..|..|  ||.:.  ..:|.||.|:.||.|||::.|..|||||:|||:..|.|.|...
 Worm    32 PELGEYSPSGENG--IDGEE--STICSVCCDEASGRHYGVVACFGCKGFFRRTVRAGKNYVCRYS 92

  Fly   548 RSCHIDKTQRKRCPYCRFQKCLEVGMKLEAVRADRMRGGRNKFGPMYKRDRARKLQVMRQRQLAL 612
            :.|.|||..|..|..|||||||||||:.:|:|.||.:.||.|..........:|:.|  ...|..
 Worm    93 KKCRIDKAGRNVCRSCRFQKCLEVGMEPDAIRPDRDKTGRQKNPRRNTEGSIKKVSV--GSILGD 155

  Fly   613 QALRNSMGPDIKPTPISPGYQQAYPNMNIKQE-IQIPQVSSLTQSPDSSPSPIAIALGQVNASTG 676
            ....|....|......||..:.....|:::.. |....:::||:..:     |.|.| |.|..|.
 Worm   156 LPCLNKFKDDSDDAATSPSSRADSAPMDLRPSFIDESVLTTLTEIEN-----IVIQL-QDNFETN 214

  Fly   677 GVIATPMNAGTGGSGGGGLNGPSSVG-----NGNSSNGSSNGNNNSS 718
            .....||        |..:..||.:.     |.|.:.|.::.|..||
 Worm   215 QQSLPPM--------GEAITKPSLIAARTLLNFNGAKGVADANCVSS 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ftz-f1NP_524143.2 NR_DBD_Lrh-1_like 508..600 CDD:143541 45/91 (49%)
NR_LBD_Ftz-F1_like 794..1024 CDD:132742
nhr-3NP_510423.1 NR_DBD_HNF4A 53..128 CDD:143518 41/74 (55%)
NR_LBD 249..432 CDD:132726 3/5 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5899
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24086
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.