DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg3 and Atg10

DIOPT Version :9

Sequence 1:NP_649059.1 Gene:Atg3 / 40044 FlyBaseID:FBgn0036813 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001097215.1 Gene:Atg10 / 50253 FlyBaseID:FBgn0040780 Length:172 Species:Drosophila melanogaster


Alignment Length:149 Identity:36/149 - (24%)
Similarity:62/149 - (41%) Gaps:25/149 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 ESGMLELVDPAVATTTRKPEPEAKASPVAAASGDAEASGDSVLHTRTYDLHISYDKYYQTPRLWV 232
            ::.:||..|      :.:|....|.|......|..:.|.:.|    :.:.|:.:...||.|.|:.
  Fly    25 DNWILEQKD------SNEPNTYLKCSQKIKCRGGKDNSAELV----SVEYHVVFSVSYQVPMLFF 79

  Fly   233 VGYDEQRKPLTVEQ-----MYEDVSQDHAKKTVTMESHPHLPGPNMASVHPCRHADIMK------ 286
            ..:......|.||.     |.|..:.| ..:.:|...||.|..|.|| :||||.|:::|      
  Fly    80 QAHRSDGSLLDVEATWRMFMPESKASD-LHQILTQMDHPVLFRPFMA-LHPCRTAEVLKQFGKPS 142

  Fly   287 --KIIQTVEEGGGQLGVHL 303
              :::..:...|..:.:||
  Fly   143 CNQVLTFISLYGPHVQLHL 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg3NP_649059.1 Autophagy_N 8..135 CDD:281916
Autophagy_act_C 219..280 CDD:281917 19/65 (29%)
Autophagy_C 301..325 CDD:287367 2/3 (67%)
Atg10NP_001097215.1 Autophagy_act_C 66..130 CDD:281917 19/65 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12866
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.