DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nufip and SPBC16C6.03c

DIOPT Version :9

Sequence 1:NP_649058.1 Gene:Nufip / 40043 FlyBaseID:FBgn0036812 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_596801.3 Gene:SPBC16C6.03c / 2539890 PomBaseID:SPBC16C6.03c Length:207 Species:Schizosaccharomyces pombe


Alignment Length:136 Identity:32/136 - (23%)
Similarity:52/136 - (38%) Gaps:35/136 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 CPADDCDFAALHNILERHIESNHITGTYVKVKKVWSEEELAAWRAERRKKFPTAANVELARLAKE 173
            |..|..::....||                  .:.:.||:.||..||:|.:||.:|:.    :|:
pombe    84 CAVDGIEYLKRRNI------------------SINTPEEIEAWIQERKKNWPTESNIR----SKQ 126

  Fly   174 QRIKRGERLEASKSRFGNREDRQRTRGGPQGDHKVRFDPKNKKKRCAKGKANEKKKKRVGTDKAN 238
            ::.|..|.|.|:.:  ....|.|.|   |........:|..|:        ...|||.:.|...|
pombe   127 EKEKVMENLGAADT--SQSIDAQPT---PSQHPLAHHEPHEKR--------GPPKKKSLYTKLLN 178

  Fly   239 EALKQK 244
            ..|:|:
pombe   179 TQLEQE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NufipNP_649058.1 NUFIP1 126..180 CDD:402194 12/53 (23%)
SPBC16C6.03cNP_596801.3 NUFIP1 <96..130 CDD:287432 13/55 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006990
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.