DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12477 and MKRN3

DIOPT Version :9

Sequence 1:NP_649055.1 Gene:CG12477 / 40040 FlyBaseID:FBgn0036809 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_005655.1 Gene:MKRN3 / 7681 HGNCID:7114 Length:507 Species:Homo sapiens


Alignment Length:280 Identity:90/280 - (32%)
Similarity:132/280 - (47%) Gaps:38/280 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VLPVPSTNSPSSQIEQKGNEAIVPNYKAATAGEQGEAQAGATCTTV-----------AVRPSGVA 68
            |...|.....||:.|:| ..|:....:......:|....|.:|..:           .:.|...|
Human   217 VASAPEAPLQSSETERK-QMAVGSGLRFCYYASRGVCFRGESCMYLHGDICDMCGLQTLHPMDAA 280

  Fly    69 TSADIVKGSSSVSSHVQPSWRSSFA--RSQDKKCGICFETIMEKEG-GDKRFGILPSCNHVFCFQ 130
            ...:.::  :.:.:| :.....|||  |..||.||||.|.:.||.. .|:|||||.:|||.||.:
Human   281 QREEHMR--ACIEAH-EKDMELSFAVQRGMDKVCGICMEVVYEKANPNDRRFGILSNCNHSFCIR 342

  Fly   131 CICTWRHATQYAYQVTRACPECRVWSNFVCPSAFWVEEKVAKDQLINDHLAAMRARDCKYFKQGQ 195
            ||..||.|.|:..::.::||:|||.|..|.||.|||||:..|.:||..:..||..:.|:||.:|:
Human   343 CIRRWRSARQFENRIVKSCPQCRVTSELVIPSEFWVEEEEEKQKLIQQYKEAMSNKACRYFAEGR 407

  Fly   196 GVCLFGNKCFYKHSIPNADYVDVGLP--------THALGLPIPSDFSGLGNC--------LILVP 244
            |.|.||:.|||||..|.....:...|        .|.|..|:.   .|.||.        |:::.
Human   408 GNCPFGDTCFYKHEYPEGWGDEPPGPGGGSFSAYWHQLVEPVR---MGEGNMLYKSIKKELVVLR 469

  Fly   245 FPNMFFDDF-SNSDDYDFSD 263
            ..::.|..| |..|:..||:
Human   470 LASLLFKRFLSLRDELPFSE 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12477NP_649055.1 RING 99..153 CDD:238093 26/54 (48%)
MKRN3NP_005655.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48
DNA_pol3_gamma3 <33..232 CDD:331207 4/14 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 69..89
ZnF_C3H1 95..121 CDD:214632
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..149
PHA02929 <252..400 CDD:331986 54/150 (36%)
Makorin-type Cys-His 266..293 2/28 (7%)
RING-HC_MKRN1_3 308..368 CDD:319644 31/59 (53%)
RING-HC finger (C3HC4-type) 311..364 CDD:319644 26/52 (50%)
MKRN1_C 439..505 CDD:318109 13/54 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 0.172 Domainoid score I8156
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3270
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1388677at2759
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11224
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.