DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12477 and Mkrn2

DIOPT Version :9

Sequence 1:NP_649055.1 Gene:CG12477 / 40040 FlyBaseID:FBgn0036809 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_075779.2 Gene:Mkrn2 / 67027 MGIID:1914277 Length:416 Species:Mus musculus


Alignment Length:227 Identity:78/227 - (34%)
Similarity:113/227 - (49%) Gaps:25/227 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VDTGVLPVPSTNSPSSQIEQKGNEAIVPNYKAATAGEQGEAQAGATCTTV-----------AVRP 64
            :.||:..:.:::|.|       ||..:..|.||     ||.:.|..|..:           .:.|
Mouse   151 IRTGLDDLEASSSYS-------NEPQLCPYAAA-----GECRFGDACVYLHGDMCEICRLQVLHP 203

  Fly    65 SGVATSADIVKGSSSVSSHVQPSWRSSFARSQDKKCGICFETIMEK-EGGDKRFGILPSCNHVFC 128
            ..........|...|...| :.....:|..||||.|.||.|.|:|| ...::|||||.:|:|.:|
Mouse   204 FDPEQRKAHEKMCMSTFEH-EMEKAFAFQASQDKVCSICMEVILEKASASERRFGILSNCSHTYC 267

  Fly   129 FQCICTWRHATQYAYQVTRACPECRVWSNFVCPSAFWVEEKVAKDQLINDHLAAMRARDCKYFKQ 193
            ..||..||.|.|:...:.::||||||.|.||.||.:|||::..|::||......|..:.||||:|
Mouse   268 LSCIRQWRCAKQFENPIIKSCPECRVISEFVIPSVYWVEDQNKKNELIEAFKQGMGKKACKYFEQ 332

  Fly   194 GQGVCLFGNKCFYKHSIPNADYVDVGLPTHAL 225
            |:|.|.||:||.|:|:.|:....:...|...|
Mouse   333 GKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQL 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12477NP_649055.1 RING 99..153 CDD:238093 24/54 (44%)
Mkrn2NP_075779.2 ZnF_C3H1 2..28 CDD:214632
ZnF_C3H1 35..55 CDD:214632
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..144
PHA03096 <178..327 CDD:222981 51/149 (34%)
Makorin-type Cys-His 193..222 3/28 (11%)
RING 238..292 CDD:238093 24/53 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I8159
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11224
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.