DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12477 and mkrn4

DIOPT Version :9

Sequence 1:NP_649055.1 Gene:CG12477 / 40040 FlyBaseID:FBgn0036809 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_005167100.1 Gene:mkrn4 / 559882 ZFINID:ZDB-GENE-030131-5954 Length:402 Species:Danio rerio


Alignment Length:240 Identity:79/240 - (32%)
Similarity:113/240 - (47%) Gaps:49/240 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTVASNDQHVDTGVL---------PVP-------------STNSPSSQIEQKGNEAIVPNYKAA 43
            ||.:..|.:.:.||:.         .||             :|:|.||.           || .:
Zfish   131 MSALQRNFERLTTGIAEEEESGVVEDVPLQLGASRTLYQSNATHSSSSH-----------NY-TS 183

  Fly    44 TAGEQGEAQAGATCTTVAVRPSGVATSADIVKG--SSSVSSHVQPSWRSSFARSQDKKCGICFET 106
            |:.....|...||..|||...:.| |.:.:..|  :::|||..|.|  .:|.:|.|..||||.:.
Zfish   184 TSFMAAPAPVEATKITVAEAETQV-TKSPVRSGQVAAAVSSVQQCS--GAFDQSNDVACGICMDK 245

  Fly   107 IMEKE-GGDKRFGILPSCNHVFCFQCICTWRHATQYAYQVTRACPECRVWSNFVCPSAFWVEEKV 170
            |.||. ..::|:||||:|||.||..||.|||....:..:|.:.||:|||.|:|..||..||.:..
Zfish   246 ISEKSTAQERRYGILPNCNHAFCIGCIVTWRKTKDFQEEVIKGCPQCRVKSSFYIPSKHWVCDGE 310

  Fly   171 AKDQLINDHLAAMRARD----CKYFKQGQGVCLFGNKCFYKHSIP 211
            .|..||    |:.:.|.    |.:|.: .|.|.|.::|.|.|.:|
Zfish   311 EKASLI----ASFKERSSKLKCTFFMR-HGCCPFKSECIYSHDMP 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12477NP_649055.1 RING 99..153 CDD:238093 25/54 (46%)
mkrn4XP_005167100.1 ZnF_C3H1 <53..73 CDD:214632
RING 239..293 CDD:238093 25/53 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580292
Domainoid 1 1.000 79 1.000 Domainoid score I8592
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1388677at2759
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11224
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.