DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12477 and Mkrn1

DIOPT Version :9

Sequence 1:NP_649055.1 Gene:CG12477 / 40040 FlyBaseID:FBgn0036809 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_061280.2 Gene:Mkrn1 / 54484 MGIID:1859353 Length:481 Species:Mus musculus


Alignment Length:209 Identity:76/209 - (36%)
Similarity:110/209 - (52%) Gaps:17/209 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VPSTNSPSSQIEQKGNEAIVPNYKAATAGEQGEAQAGATCTTV-----------AVRPSGVATSA 71
            ||...|.:.:..:|....:....:.......||.:.|..|..:           .:.|...|..:
Mouse   189 VPPQGSVTKEESEKEPTTVETKKQLCPYAAVGECRYGENCVYLHGDSCDMCGLQVLHPVDAAQRS 253

  Fly    72 DIVKGSSSVSSHVQPSWRSSFA--RSQDKKCGICFETIMEKEG-GDKRFGILPSCNHVFCFQCIC 133
            ..:|  |.:.:| :.....|||  ||:|..||||.|.:.||.. .::|||||.:|||.:|.:||.
Mouse   254 QHIK--SCIEAH-EKDMELSFAVQRSKDMVCGICMEVVYEKANPSERRFGILSNCNHTYCLKCIR 315

  Fly   134 TWRHATQYAYQVTRACPECRVWSNFVCPSAFWVEEKVAKDQLINDHLAAMRARDCKYFKQGQGVC 198
            .||.|.|:..::.::|||||:.||||.||..|||||..|.:||..:..||..:.|:||.:|:|.|
Mouse   316 KWRSAKQFESKIIKSCPECRITSNFVIPSENWVEEKEEKQKLIQKYKEAMSNKACRYFDEGRGSC 380

  Fly   199 LFGNKCFYKHSIPN 212
            .||..|||||:.|:
Mouse   381 PFGGNCFYKHAYPD 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12477NP_649055.1 RING 99..153 CDD:238093 25/54 (46%)
Mkrn1NP_061280.2 zf-CCCH_4 59..80 CDD:375512
zf_CCCH_4 90..108 CDD:375772
PHA03096 <221..370 CDD:222981 57/151 (38%)
Makorin-type Cys-His 236..263 4/28 (14%)
RING-HC_MKRN1_3 278..338 CDD:319644 28/59 (47%)
RING-HC finger (C3HC4-type) 281..334 CDD:319644 24/52 (46%)
MKRN1_C 400..479 CDD:374139
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I8071
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3270
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1388677at2759
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11224
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.