DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12477 and RNF141

DIOPT Version :9

Sequence 1:NP_649055.1 Gene:CG12477 / 40040 FlyBaseID:FBgn0036809 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_057506.2 Gene:RNF141 / 50862 HGNCID:21159 Length:230 Species:Homo sapiens


Alignment Length:126 Identity:33/126 - (26%)
Similarity:53/126 - (42%) Gaps:28/126 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 VAVRPSGV----ATSADIVKGSSSVSSHVQPSWRSSFAR-SQDKKCGICFETIMEKEGGDKRFGI 119
            :..:.:||    :||.:..:.||||:|.....|.....: :.:::|.||.         |.|..:
Human   110 ITSQAAGVLAQSSTSEEPDENSSSVTSCQASLWMGRVKQLTDEEECCICM---------DGRADL 165

  Fly   120 LPSCNHVFCFQCICTW--RHATQYAYQVTRACPECRVWSNFVCPSAFW-VEEKVAKDQLIN 177
            :..|.|.||.:||..|  ||         |.||.||:  .....:..| |.:...:|.:.|
Human   166 ILPCAHSFCQKCIDKWSDRH---------RNCPICRL--QMTGANESWVVSDAPTEDDMAN 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12477NP_649055.1 RING 99..153 CDD:238093 17/55 (31%)
RNF141NP_057506.2 RING-HC_RNF141 154..192 CDD:319459 17/55 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.