DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12477 and Mkrn1

DIOPT Version :9

Sequence 1:NP_649055.1 Gene:CG12477 / 40040 FlyBaseID:FBgn0036809 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001246867.1 Gene:Mkrn1 / 44131 FlyBaseID:FBgn0029152 Length:386 Species:Drosophila melanogaster


Alignment Length:338 Identity:138/338 - (40%)
Similarity:181/338 - (53%) Gaps:86/338 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DQHVDTGVLPVPSTNSPS-------SQIEQKGNEA----IVPNYKAATAGEQG------------ 49
            ::.|.|.|||.|||:|.|       |...|:.|.|    .||:.|..||.||.            
  Fly    51 EEQVATDVLPKPSTSSSSTIGSRSASISSQQRNWANAPVFVPSQKRYTAHEQSEFETTVDPEAVM 115

  Fly    50 EAQAGATCTTVAVRPSGVATSADIVKGSSSVSS--------------------HV---------- 84
            ||||||:..|:|   .||:. |::|.|.||::.                    |:          
  Fly   116 EAQAGASYDTLA---PGVSW-AEVVGGPSSLNKEDYGEENSSCAWGEFSAYPIHMELCEMCDQYC 176

  Fly    85 -----QPSWRS-----------------SFARSQDKKCGICFETIMEKEGGDKRFGILPSCNHVF 127
                 |...||                 :.|||:||.|||||:|||||.|.:|||||||:|||:|
  Fly   177 LHPTDQVQRRSHNRECLQQHEQAMELSFAIARSKDKTCGICFDTIMEKAGREKRFGILPNCNHIF 241

  Fly   128 CFQCICTWRHATQYAYQVTRACPECRVWSNFVCPSAFWVEEKVAKDQLINDHLAAMRARDCKYFK 192
            |.:||.|||.|.|:..::|||||||||.|:||||||||:|.|..||:|:||:.||:.|:||||||
  Fly   242 CLECIRTWRQAKQFENKITRACPECRVCSDFVCPSAFWMETKEEKDKLLNDYRAALGAKDCKYFK 306

  Fly   193 QGQGVCLFGNKCFYKHSIPNADYVDVGLPTHALGLPIPSDFSGLGNCLIL-------VPFPNMFF 250
            :|:|.|.|||||||||::||.|.||||||.....|...::...|.:..:.       ..:..|..
  Fly   307 KGEGKCPFGNKCFYKHALPNGDIVDVGLPKRTRKLQSQNEIIDLLDIYLWDYVDRRDYHWLEMIS 371

  Fly   251 DDFSNSDDYDFSD 263
            .|.::|:..|:||
  Fly   372 SDITSSESSDYSD 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12477NP_649055.1 RING 99..153 CDD:238093 36/53 (68%)
Mkrn1NP_001246867.1 ZnF_C3H1 20..43 CDD:214632
RING 213..267 CDD:238093 36/53 (68%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448395
Domainoid 1 1.000 75 1.000 Domainoid score I3185
eggNOG 1 0.900 - - E1_KOG1039
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I1531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116581at6656
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 1 1.000 - - mtm1123
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11224
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.