DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12477 and CG5334

DIOPT Version :9

Sequence 1:NP_649055.1 Gene:CG12477 / 40040 FlyBaseID:FBgn0036809 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_572969.1 Gene:CG5334 / 32402 FlyBaseID:FBgn0030577 Length:210 Species:Drosophila melanogaster


Alignment Length:155 Identity:75/155 - (48%)
Similarity:99/155 - (63%) Gaps:9/155 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VRPSGVATSADIVKGSSS------VSSHVQPSWRSSF--ARSQDKKCGICFETIMEKEGGDKRFG 118
            :||. ::.:||.|.|.::      ..::.....:.||  |:||||.||||.||:::|.|.:.|||
  Fly    38 LRPQ-ISNNADEVVGHANRYSRPMTGANATEEMKLSFAIAKSQDKMCGICLETVVKKRGRECRFG 101

  Fly   119 ILPSCNHVFCFQCICTWRHATQYAYQVTRACPECRVWSNFVCPSAFWVEEKVAKDQLINDHLAAM 183
            |||.|.|:||..||..||.|......|.|.||||||:|.||||||:||:.|..||:|::::.|||
  Fly   102 ILPKCKHIFCLTCIRRWRQAEYIEDNVKRGCPECRVFSEFVCPSAYWVDTKEEKDKLLSEYRAAM 166

  Fly   184 RARDCKYFKQGQGVCLFGNKCFYKH 208
            .|:|||||..|.|.|.||..|||.|
  Fly   167 GAKDCKYFNGGLGKCPFGTNCFYNH 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12477NP_649055.1 RING 99..153 CDD:238093 28/53 (53%)
CG5334NP_572969.1 RING 82..136 CDD:238093 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448398
Domainoid 1 1.000 75 1.000 Domainoid score I3185
eggNOG 1 0.900 - - E1_KOG1039
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I1531
Isobase 1 0.950 - 0 Normalized mean entropy S3270
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116581at6656
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 1 1.000 - - mtm1123
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11224
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.850

Return to query results.
Submit another query.