DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12477 and Mkrn2

DIOPT Version :9

Sequence 1:NP_649055.1 Gene:CG12477 / 40040 FlyBaseID:FBgn0036809 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001008315.1 Gene:Mkrn2 / 297525 RGDID:1310618 Length:417 Species:Rattus norvegicus


Alignment Length:267 Identity:86/267 - (32%)
Similarity:121/267 - (45%) Gaps:51/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TVASNDQHVDTGV----LPVPST-------NSPSSQIEQK---------------------GNEA 35
            |:...|::: ||:    .|.|||       |.|.:..|.|                     .||.
  Rat   106 TLVLRDRNL-TGLAEDKTPPPSTVNNPGGCNDPQTSPEMKPHSYLDAIRTGLDDLEASSSYSNEQ 169

  Fly    36 IVPNYKAATAGEQGEAQAGATCTTV-----------AVRPSGVATSADIVKGSSSVSSHVQPSWR 89
            .:..|.||     ||.:.|..|..:           .:.|..........|...|...| :....
  Rat   170 QLCPYAAA-----GECRFGDACVYLHGDMCEICRLQVLHPFDPEQRKAHEKMCMSTFEH-EMEKA 228

  Fly    90 SSFARSQDKKCGICFETIMEK-EGGDKRFGILPSCNHVFCFQCICTWRHATQYAYQVTRACPECR 153
            .:|..||||.|.||.|.|:|| ...::|||||.:|:|.:|..||..||.|.|:...:.::|||||
  Rat   229 FAFQASQDKVCSICMEVILEKASASERRFGILSNCSHTYCLSCIRQWRCAKQFENPIIKSCPECR 293

  Fly   154 VWSNFVCPSAFWVEEKVAKDQLINDHLAAMRARDCKYFKQGQGVCLFGNKCFYKHSIPNADYVDV 218
            |.|.||.||.:|||::..|::||......|..:.||||:||:|.|.||:||.|:|:.|:....:.
  Rat   294 VISEFVIPSVYWVEDQNKKNELIEAFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEP 358

  Fly   219 GLPTHAL 225
            ..|...|
  Rat   359 EKPRKQL 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12477NP_649055.1 RING 99..153 CDD:238093 24/54 (44%)
Mkrn2NP_001008315.1 zf-CCCH_4 6..27 CDD:407881
zf_CCCH_4 37..55 CDD:408151
PHA03096 <179..328 CDD:222981 51/149 (34%)
RING-HC_MKRN2 236..293 CDD:319645 26/56 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I7980
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1388677at2759
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11224
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.