DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12477 and Mkrn1

DIOPT Version :9

Sequence 1:NP_649055.1 Gene:CG12477 / 40040 FlyBaseID:FBgn0036809 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_006236363.1 Gene:Mkrn1 / 296988 RGDID:1303251 Length:481 Species:Rattus norvegicus


Alignment Length:209 Identity:76/209 - (36%)
Similarity:111/209 - (53%) Gaps:17/209 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VPSTNSPSSQIEQKGNEAIVPNYKAATAGEQGEAQAGATCTTV-----------AVRPSGVATSA 71
            ||...|.:.:..:|....:....:.......||.:.|..|..:           .:.|...|..:
  Rat   189 VPLQGSVTKEESEKEPTTVETEKQLCPYAAVGECRYGENCVYLHGDSCDMCGLQVLHPMDAAQRS 253

  Fly    72 DIVKGSSSVSSHVQPSWRSSFA--RSQDKKCGICFETIMEKEG-GDKRFGILPSCNHVFCFQCIC 133
            ..:|  |.:.:| :.....|||  ||:|..||||.|.:.||.. .::|||||.:|||.:|.:||.
  Rat   254 QHIK--SCIEAH-EKDMELSFAVQRSKDMVCGICMEVVYEKANPSERRFGILSNCNHTYCLKCIR 315

  Fly   134 TWRHATQYAYQVTRACPECRVWSNFVCPSAFWVEEKVAKDQLINDHLAAMRARDCKYFKQGQGVC 198
            .||.|.|:..::.::|||||:.||||.||.:|||||..|.:||..:..||..:.|:||.:|:|.|
  Rat   316 KWRSAKQFESKIIKSCPECRITSNFVIPSEYWVEEKEEKQKLIQKYKEAMSNKACRYFDEGRGSC 380

  Fly   199 LFGNKCFYKHSIPN 212
            .||..|||||:.|:
  Rat   381 PFGGNCFYKHAYPD 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12477NP_649055.1 RING 99..153 CDD:238093 25/54 (46%)
Mkrn1XP_006236363.1 ZnF_C3H1 55..81 CDD:214632
ZnF_C3H1 88..110 CDD:214632
PHA03096 <221..370 CDD:222981 57/151 (38%)
RING 281..335 CDD:238093 25/53 (47%)
MKRN1_C 400..479 CDD:292443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I7889
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1388677at2759
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11224
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.