DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12477 and Mkrn3

DIOPT Version :9

Sequence 1:NP_649055.1 Gene:CG12477 / 40040 FlyBaseID:FBgn0036809 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_038956927.1 Gene:Mkrn3 / 292988 RGDID:1311197 Length:528 Species:Rattus norvegicus


Alignment Length:207 Identity:78/207 - (37%)
Similarity:111/207 - (53%) Gaps:18/207 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QHVDTGV-LPVPSTNSPSSQIEQKGNEAIVPNYKAATAGEQGEAQAGATCTTVAVRPSGVATSAD 72
            :|:..|: :|:|.....:.....:|:....|:      ||..:     .|...|:.|...|... 
  Rat   251 EHMAMGMGMPLPLCRYAARGQCLRGDRCAYPH------GEICD-----MCGQQALHPWDAAQQE- 303

  Fly    73 IVKGSSSVSSHVQPSWRSSFA--RSQDKKCGICFETIMEK-EGGDKRFGILPSCNHVFCFQCICT 134
             ....:.|.:| :.....|||  ||.||.||||.|.:.|| :..|:|||||.||||.:|.:||..
  Rat   304 -AHRRACVEAH-ERDMELSFAVQRSMDKVCGICMEVVYEKADPSDRRFGILFSCNHTYCLKCIRR 366

  Fly   135 WRHATQYAYQVTRACPECRVWSNFVCPSAFWVEEKVAKDQLINDHLAAMRARDCKYFKQGQGVCL 199
            ||.|||:..:::::||:|||.|.||.||.|||||:..|::|:..:...|..:.|:||..|.|.|.
  Rat   367 WRSATQFENRISKSCPQCRVSSGFVIPSEFWVEEEEEKEKLVQQYKEGMSQKACRYFAGGLGHCP 431

  Fly   200 FGNKCFYKHSIP 211
            ||..|||||..|
  Rat   432 FGEFCFYKHEYP 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12477NP_649055.1 RING 99..153 CDD:238093 27/54 (50%)
Mkrn3XP_038956927.1 zf-CCCH_4 96..117 CDD:407881
PHA03096 <272..420 CDD:222981 60/161 (37%)
RING-HC_MKRN1_3 328..388 CDD:319644 32/59 (54%)
MKRN1_C 442..528 CDD:406294 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I7889
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1388677at2759
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11224
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.