DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12477 and cps3

DIOPT Version :9

Sequence 1:NP_649055.1 Gene:CG12477 / 40040 FlyBaseID:FBgn0036809 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_594201.1 Gene:cps3 / 2543054 PomBaseID:SPAC3A11.02 Length:583 Species:Schizosaccharomyces pombe


Alignment Length:134 Identity:32/134 - (23%)
Similarity:54/134 - (40%) Gaps:35/134 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 HATQY---AYQVTRACPE------CRVWSNFVCPSA----FWVEEKVAKDQLINDHLAAMRARDC 188
            |.:::   |..:||..|:      |:.:....|.|.    |..:.::|.::.|           |
pombe    17 HLSEFNSEATSLTRPSPKSLQHVPCKFFRQGTCTSGKNCIFSHDLELATEKTI-----------C 70

  Fly   189 KYFKQGQGVCLFGNKCFYKHSIPNADYVDVGLPTHALGLPIPSDFSGLGNCLILVPFPNMFFDDF 253
            |||::|.  |.||:||..:|.:|:...|    .|.|.. |..:........:...|..|:    .
pombe    71 KYFQKGN--CKFGSKCALEHVLPDGRKV----KTRAFA-PSTTAMGSSSQNISAAPMANI----I 124

  Fly   254 SNSD 257
            ||:|
pombe   125 SNND 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12477NP_649055.1 RING 99..153 CDD:238093 5/24 (21%)
cps3NP_594201.1 ZnF_C3H1 37..61 CDD:214632 4/23 (17%)
ZnF_C3H1 66..90 CDD:214632 12/36 (33%)
YTH1 258..566 CDD:227416
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11224
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.