DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12477 and SPCC1739.01

DIOPT Version :9

Sequence 1:NP_649055.1 Gene:CG12477 / 40040 FlyBaseID:FBgn0036809 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_588409.2 Gene:SPCC1739.01 / 2539315 PomBaseID:SPCC1739.01 Length:547 Species:Schizosaccharomyces pombe


Alignment Length:74 Identity:19/74 - (25%)
Similarity:28/74 - (37%) Gaps:11/74 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 CRVWSNFVCPSAFWVEEKVAKDQLINDHLAAMRARDCKYFKQGQGVCLFGNKCFYKHSIPNADYV 216
            |:.:.|..|         .|.:.....|........||||.:|.  |.||.||...|::|....:
pombe    47 CKFFRNGTC---------TAGENCPFSHSLETERPICKYFLKGN--CKFGPKCALSHALPGNTNL 100

  Fly   217 DVGLPTHAL 225
            ..|..|:.:
pombe   101 PNGTSTNTM 109

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity