DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12477 and MKRN2

DIOPT Version :9

Sequence 1:NP_649055.1 Gene:CG12477 / 40040 FlyBaseID:FBgn0036809 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_054879.3 Gene:MKRN2 / 23609 HGNCID:7113 Length:416 Species:Homo sapiens


Alignment Length:189 Identity:71/189 - (37%)
Similarity:100/189 - (52%) Gaps:31/189 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 SFARSQDKKCGICFETIMEK-EGGDKRFGILPSCNHVFCFQCICTWRHATQYAYQVTRACPECRV 154
            :|..||||.|.||.|.|:|| ...::|||||.:|||.:|..||..||.|.|:...:.::||||||
Human   229 AFQASQDKVCSICMEVILEKASASERRFGILSNCNHTYCLSCIRQWRCAKQFENPIIKSCPECRV 293

  Fly   155 WSNFVCPSAFWVEEKVAKDQLINDHLAAMRARDCKYFKQGQGVCLFGNKCFYKHSIPNADYVDVG 219
            .|.||.||.:|||::..|::||......|..:.||||:||:|.|.||:||.|:|:.|:....:..
Human   294 ISEFVIPSVYWVEDQNKKNELIEAFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPE 358

  Fly   220 LPTHALGLPIPSDFSGLGNCLILVPFPNMFFD-----DF---------SNSDDYDFSDV 264
            .|...|        |..|..        .||:     ||         .|::|.|.:::
Human   359 KPRKQL--------SSQGTV--------RFFNSVRLWDFIENRESRHVPNNEDVDMTEL 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12477NP_649055.1 RING 99..153 CDD:238093 25/54 (46%)
MKRN2NP_054879.3 ZnF_C3H1 2..28 CDD:214632
ZnF_C3H1 35..55 CDD:214632
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..142
PHA03096 <178..327 CDD:222981 45/97 (46%)
Makorin-type Cys-His 193..222
RING 238..292 CDD:238093 25/53 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 0.172 Domainoid score I8156
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1388677at2759
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11224
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.