DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12477 and MKRN1

DIOPT Version :9

Sequence 1:NP_649055.1 Gene:CG12477 / 40040 FlyBaseID:FBgn0036809 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_038474.2 Gene:MKRN1 / 23608 HGNCID:7112 Length:482 Species:Homo sapiens


Alignment Length:208 Identity:76/208 - (36%)
Similarity:111/208 - (53%) Gaps:17/208 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PSTNSPSSQIEQKGNEAIVPNYKAATAGEQGEAQAGATCTTV-----------AVRPSGVATSAD 72
            |...|.:.:..:|...|:....:.......||.:.|..|..:           .:.|...|..:.
Human   190 PLQGSVTKEESEKEQTAVETKKQLCPYAAVGECRYGENCVYLHGDSCDMCGLQVLHPMDAAQRSQ 254

  Fly    73 IVKGSSSVSSHVQPSWRSSFA--RSQDKKCGICFETIMEKEG-GDKRFGILPSCNHVFCFQCICT 134
            .:|  |.:.:| :.....|||  ||:|..||||.|.:.||.. .::|||||.:|||.:|.:||..
Human   255 HIK--SCIEAH-EKDMELSFAVQRSKDMVCGICMEVVYEKANPSERRFGILSNCNHTYCLKCIRK 316

  Fly   135 WRHATQYAYQVTRACPECRVWSNFVCPSAFWVEEKVAKDQLINDHLAAMRARDCKYFKQGQGVCL 199
            ||.|.|:..::.::|||||:.||||.||.:|||||..|.:||..:..||..:.|:||.:|:|.|.
Human   317 WRSAKQFESKIIKSCPECRITSNFVIPSEYWVEEKEEKQKLILKYKEAMSNKACRYFDEGRGSCP 381

  Fly   200 FGNKCFYKHSIPN 212
            ||..|||||:.|:
Human   382 FGGNCFYKHAYPD 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12477NP_649055.1 RING 99..153 CDD:238093 25/54 (46%)
MKRN1NP_038474.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..52
ZnF_C3H1 55..81 CDD:214632
ZnF_C3H1 88..110 CDD:214632
PHA03096 <221..370 CDD:222981 57/151 (38%)
Makorin-type Cys-His 236..263 4/28 (14%)
RING 281..335 CDD:238093 25/53 (47%)
MKRN1_C 400..480 CDD:292443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 0.172 Domainoid score I8156
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3270
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1388677at2759
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11224
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.