DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12477 and MKRN1

DIOPT Version :10

Sequence 1:NP_649055.1 Gene:CG12477 / 40040 FlyBaseID:FBgn0036809 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_038474.2 Gene:MKRN1 / 23608 HGNCID:7112 Length:482 Species:Homo sapiens


Alignment Length:208 Identity:76/208 - (36%)
Similarity:111/208 - (53%) Gaps:17/208 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PSTNSPSSQIEQKGNEAIVPNYKAATAGEQGEAQAGATCTTV-----------AVRPSGVATSAD 72
            |...|.:.:..:|...|:....:.......||.:.|..|..:           .:.|...|..:.
Human   190 PLQGSVTKEESEKEQTAVETKKQLCPYAAVGECRYGENCVYLHGDSCDMCGLQVLHPMDAAQRSQ 254

  Fly    73 IVKGSSSVSSHVQPSWRSSFA--RSQDKKCGICFETIMEKEG-GDKRFGILPSCNHVFCFQCICT 134
            .:|  |.:.:| :.....|||  ||:|..||||.|.:.||.. .::|||||.:|||.:|.:||..
Human   255 HIK--SCIEAH-EKDMELSFAVQRSKDMVCGICMEVVYEKANPSERRFGILSNCNHTYCLKCIRK 316

  Fly   135 WRHATQYAYQVTRACPECRVWSNFVCPSAFWVEEKVAKDQLINDHLAAMRARDCKYFKQGQGVCL 199
            ||.|.|:..::.::|||||:.||||.||.:|||||..|.:||..:..||..:.|:||.:|:|.|.
Human   317 WRSAKQFESKIIKSCPECRITSNFVIPSEYWVEEKEEKQKLILKYKEAMSNKACRYFDEGRGSCP 381

  Fly   200 FGNKCFYKHSIPN 212
            ||..|||||:.|:
Human   382 FGGNCFYKHAYPD 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12477NP_649055.1 RING_Ubox 97..156 CDD:473075 28/59 (47%)
MKRN1NP_038474.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..52
zf-CCCH_4 59..80 CDD:465626
zf_CCCH_4 90..108 CDD:465719
PHA03096 <221..370 CDD:222981 57/151 (38%)
Makorin-type Cys-His 236..263 4/28 (14%)
RING-HC_MKRN1_3 278..338 CDD:319644 28/59 (47%)
MKRN1_C 392..482 CDD:464890 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.