DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12477 and Mkrn3

DIOPT Version :9

Sequence 1:NP_649055.1 Gene:CG12477 / 40040 FlyBaseID:FBgn0036809 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_035876.2 Gene:Mkrn3 / 22652 MGIID:2181178 Length:544 Species:Mus musculus


Alignment Length:124 Identity:64/124 - (51%)
Similarity:83/124 - (66%) Gaps:3/124 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 SFA--RSQDKKCGICFETIMEK-EGGDKRFGILPSCNHVFCFQCICTWRHATQYAYQVTRACPEC 152
            |||  ||.||.||||.|.:.|| :..|:|||||.||||.:|.:||..||.|||:..:::::||:|
Mouse   336 SFAVQRSMDKVCGICMEVVYEKADPSDRRFGILFSCNHTYCLRCIRRWRSATQFENRISKSCPQC 400

  Fly   153 RVWSNFVCPSAFWVEEKVAKDQLINDHLAAMRARDCKYFKQGQGVCLFGNKCFYKHSIP 211
            ||.|.||.||.|||||:..|::|:..:...|..:.|:||..|.|.|.||..|||||..|
Mouse   401 RVSSGFVIPSEFWVEEEEEKEKLVQQYKEGMSQKACRYFAGGLGHCPFGEFCFYKHEYP 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12477NP_649055.1 RING 99..153 CDD:238093 27/54 (50%)
Mkrn3NP_035876.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46
ZnF_C3H1 92..118 CDD:214632
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..144
Makorin-type Cys-His 302..329
RING 347..401 CDD:238093 27/53 (51%)
MKRN1_C 467..542 CDD:292443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I8071
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1388677at2759
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11224
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.