DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12477 and F54B11.5

DIOPT Version :9

Sequence 1:NP_649055.1 Gene:CG12477 / 40040 FlyBaseID:FBgn0036809 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_510276.1 Gene:F54B11.5 / 186213 WormBaseID:WBGene00010028 Length:201 Species:Caenorhabditis elegans


Alignment Length:113 Identity:30/113 - (26%)
Similarity:47/113 - (41%) Gaps:21/113 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 IVKGSSSVSSHVQPSWRSSFARSQ----DKKCGICFETIMEKEGGDKRFGILPSCNHVFCFQCIC 133
            ::....|....|.|...|.|..:|    :..|.||.|.|.:         :|..|.|.||.:|| 
 Worm    98 MITNKESRKRSVDPMSTSQFILTQTSDVEGNCVICMENIND---------LLLPCLHAFCIRCI- 152

  Fly   134 TWRHATQYAYQVTRACPECRVWSNFVCPSAFWVEEKVAKDQL-INDHL 180
                |.:..|:...:||.|:........|::.|.:  |.||. :|::|
 Worm   153 ----ANEMEYRHDFSCPICKTKIRNPIESSWEVPD--APDQAEVNEYL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12477NP_649055.1 RING 99..153 CDD:238093 16/53 (30%)
F54B11.5NP_510276.1 COG5540 <83..174 CDD:227827 23/89 (26%)
RING_Ubox 129..168 CDD:388418 16/52 (31%)
RING-HC finger (C3HC4-type) 129..167 CDD:319361 16/51 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.