powered by:
Protein Alignment CG12477 and ccch-1
DIOPT Version :9
Sequence 1: | NP_649055.1 |
Gene: | CG12477 / 40040 |
FlyBaseID: | FBgn0036809 |
Length: | 265 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_505926.2 |
Gene: | ccch-1 / 179584 |
WormBaseID: | WBGene00009532 |
Length: | 460 |
Species: | Caenorhabditis elegans |
Alignment Length: | 68 |
Identity: | 14/68 - (20%) |
Similarity: | 27/68 - (39%) |
Gaps: | 15/68 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 188 CKYFKQGQGVCLFGNKCFYKHSIPNADYVDVGLPTHALGLPIPSDFSGLGNCLILVPFPNMFFDD 252
|:.|.| .|.|.:|.:|.:.|:.|.:.......| :..|:|...: |:::...
Worm 242 CQSFHQ-SGYCPYGPRCHFIHNEPPSAQSQYSTP---ISTPVPHQTT-----------PSLYASQ 291
Fly 253 FSN 255
:.|
Worm 292 YHN 294
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S3270 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.