DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12477 and mkrn2

DIOPT Version :9

Sequence 1:NP_649055.1 Gene:CG12477 / 40040 FlyBaseID:FBgn0036809 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_694511.1 Gene:mkrn2 / 170783 ZFINID:ZDB-GENE-020213-2 Length:414 Species:Danio rerio


Alignment Length:223 Identity:80/223 - (35%)
Similarity:107/223 - (47%) Gaps:36/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PSSQIE--QKGNEAIVPNYKAATAGEQGEAQ--AGATCTTVAVRPSGVATSADIVKGS--SSVSS 82
            |.|.:|  :.|.:|...  .|||||...|.|  :...|..:|........|...:.|.  .....
Zfish   135 PHSYLEAIRSGLDASAA--AAATAGTFPELQQTSPQICPFLAAGQCQYGESCPYLHGEMCEICRQ 197

  Fly    83 HV----QPSWRS----------------SFA--RSQDKKCGICFETIMEKEG-GDKRFGILPSCN 124
            ||    .|..|:                :||  :||||.|.||.:.:.||.. .::|||||.||.
Zfish   198 HVLHPHDPEQRAAHEKKCMVAFEMDMERAFAVQQSQDKVCKICLDVVYEKSSPSERRFGILSSCA 262

  Fly   125 HVFCFQCICTWRHATQYAYQVTRACPECRVWSNFVCPSAFWVEEKVAKDQLINDHLAAMRARDCK 189
            |.:|..||..||...|...|:.::||||||.|.||.||.:|||::..|:.||.:..:.:..:.||
Zfish   263 HTYCLNCIRQWRCVEQLHNQIRKSCPECRVVSEFVIPSIYWVEDQEQKNLLIEEFKSGVSKKACK 327

  Fly   190 YFKQGQGVCLFGNKCFYKHSIPNADYVD 217
            ||.||:|.|.||.||||.|:     |.|
Zfish   328 YFDQGRGTCPFGGKCFYMHA-----YAD 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12477NP_649055.1 RING 99..153 CDD:238093 23/54 (43%)
mkrn2NP_694511.1 ZnF_C3H1 2..28 CDD:214632
ZnF_C3H1 35..57 CDD:214632
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 57..94
PHA03096 <178..326 CDD:222981 49/147 (33%)
Makorin-type Cys-His 192..221 4/28 (14%)
RING 237..291 CDD:238093 23/53 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I7675
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1388677at2759
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11224
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.980

Return to query results.
Submit another query.