DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12477 and mkrn1

DIOPT Version :9

Sequence 1:NP_649055.1 Gene:CG12477 / 40040 FlyBaseID:FBgn0036809 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_694510.1 Gene:mkrn1 / 170782 ZFINID:ZDB-GENE-020213-1 Length:439 Species:Danio rerio


Alignment Length:178 Identity:67/178 - (37%)
Similarity:101/178 - (56%) Gaps:17/178 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GEAQAGATCTTV-----------AVRPSGVATSADIVKGSSSVSSHVQPSWRSSFA--RSQDKKC 100
            ||.:.|..|..:           .:.||..:..:..::  :.:.:| :.....|||  ||:|..|
Zfish   175 GECRYGLNCAYLHGDVCDMCGLQVLHPSDTSQRSQHIR--ACIEAH-EKDMEISFAIQRSKDMMC 236

  Fly   101 GICFETIMEKEG-GDKRFGILPSCNHVFCFQCICTWRHATQYAYQVTRACPECRVWSNFVCPSAF 164
            |:|.|.:.||.. .::|||||.:|.|.:|.:||..||.|.|:..::.::|||||:.||||.||.:
Zfish   237 GVCMEVVFEKTNPSERRFGILSNCCHCYCLKCIRKWRSAKQFESKIIKSCPECRITSNFVIPSEY 301

  Fly   165 WVEEKVAKDQLINDHLAAMRARDCKYFKQGQGVCLFGNKCFYKHSIPN 212
            |||:|..|.|||..:...|..:.|:||.:|:|.|.||..|||||:.|:
Zfish   302 WVEDKEEKQQLIQKYKDGMGTKPCRYFDEGRGTCPFGANCFYKHAFPD 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12477NP_649055.1 RING 99..153 CDD:238093 23/54 (43%)
mkrn1NP_694510.1 ZnF_C3H1 18..44 CDD:214632
Torus <52..84 CDD:292749
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..118
PHA03096 <176..325 CDD:222981 52/151 (34%)
Makorin-type Cys-His. /evidence=ECO:0000255 191..218 2/28 (7%)
RING 235..290 CDD:238093 23/54 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 352..371
MKRN1_C 357..437 CDD:292443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1388677at2759
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11224
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.