Sequence 1: | NP_649055.1 | Gene: | CG12477 / 40040 | FlyBaseID: | FBgn0036809 | Length: | 265 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_004912513.1 | Gene: | mkrn1 / 100485650 | XenbaseID: | XB-GENE-959144 | Length: | 451 | Species: | Xenopus tropicalis |
Alignment Length: | 315 | Identity: | 96/315 - (30%) |
---|---|---|---|
Similarity: | 132/315 - (41%) | Gaps: | 87/315 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 PVPSTNSPSSQIEQKGNE--------------------AIVPNY-------KAATAGEQ------ 48
Fly 49 ------------------GEAQAGATCTTV-----------AVRPSGVATSADIVKGSSSVSSHV 84
Fly 85 QPSWRSSFA--RSQDKKCGICFETIMEKEG-GDKRFGILPSCNHVFCFQCICTWRHATQYAYQVT 146
Fly 147 RACPECRVWSNFVCPSAFWVEEKVAKDQLINDHLAAMRARDCKYFKQGQGVCLFGNKCFYKHSIP 211
Fly 212 NADYVDVGLPTHALGLPIPSDFSGLGNCLILVPFPNMFF--------DDFSNSDD 258 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12477 | NP_649055.1 | RING | 99..153 | CDD:238093 | 25/54 (46%) |
mkrn1 | XP_004912513.1 | YTH1 | <35..>92 | CDD:227416 | |
zf-CCCH_4 | 68..87 | CDD:375512 | |||
PHA03096 | <190..339 | CDD:222981 | 57/151 (38%) | ||
RING-HC_MKRN1_3 | 247..307 | CDD:319644 | 28/59 (47%) | ||
RING-HC finger (C3HC4-type) | 250..303 | CDD:319644 | 24/52 (46%) | ||
MKRN1_C | 369..436 | CDD:374139 | 10/39 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 81 | 1.000 | Domainoid score | I8364 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1388677at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000752 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11224 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 5.020 |