DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12477 and mkrn1

DIOPT Version :9

Sequence 1:NP_649055.1 Gene:CG12477 / 40040 FlyBaseID:FBgn0036809 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_004912513.1 Gene:mkrn1 / 100485650 XenbaseID:XB-GENE-959144 Length:451 Species:Xenopus tropicalis


Alignment Length:315 Identity:96/315 - (30%)
Similarity:132/315 - (41%) Gaps:87/315 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PVPSTNSPSSQIEQKGNE--------------------AIVPNY-------KAATAGEQ------ 48
            |..|...|||.|..|..|                    ..||..       .|.|.|.|      
 Frog   106 PSESPAEPSSNINSKAAELAASELAAGGPQAEDWVNAVEFVPGQLYSGRAPDAYTQGTQKEDECR 170

  Fly    49 ------------------GEAQAGATCTTV-----------AVRPSGVATSADIVKGSSSVSSHV 84
                              ||.:.|..|..:           .:.|...|..:..:|  |.:.:| 
 Frog   171 EQPADPELKKQLCPYAAVGECRYGENCVYLHGDPCDMCGLQVLHPVDTAQRSQHIK--SCIEAH- 232

  Fly    85 QPSWRSSFA--RSQDKKCGICFETIMEKEG-GDKRFGILPSCNHVFCFQCICTWRHATQYAYQVT 146
            :.....|||  ||:|..||||.|.:.||.. |::|||||.:|:|.:|.:||..||.|.|:..::.
 Frog   233 EKDMELSFAVQRSKDIVCGICMEVVYEKTNPGERRFGILSNCSHSYCLKCIRKWRSAKQFESKII 297

  Fly   147 RACPECRVWSNFVCPSAFWVEEKVAKDQLINDHLAAMRARDCKYFKQGQGVCLFGNKCFYKHSIP 211
            ::|||||:.||||.||.:|||||..|.:||..:..||..:.|:||.:|:|.|.||..|||||:.|
 Frog   298 KSCPECRITSNFVIPSEYWVEEKEEKQKLIQKYKEAMSNKSCRYFDEGRGTCPFGGNCFYKHAYP 362

  Fly   212 NADYVDVGLPTHALGLPIPSDFSGLGNCLILVPFPNMFF--------DDFSNSDD 258
            :....:          |.|...||:.: .......|.|:        |.|.|.:|
 Frog   363 DGRIEE----------PQPRQKSGMSS-RYRSQRRNRFWDFDERDGADPFENDED 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12477NP_649055.1 RING 99..153 CDD:238093 25/54 (46%)
mkrn1XP_004912513.1 YTH1 <35..>92 CDD:227416
zf-CCCH_4 68..87 CDD:375512
PHA03096 <190..339 CDD:222981 57/151 (38%)
RING-HC_MKRN1_3 247..307 CDD:319644 28/59 (47%)
RING-HC finger (C3HC4-type) 250..303 CDD:319644 24/52 (46%)
MKRN1_C 369..436 CDD:374139 10/39 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8364
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1388677at2759
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11224
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.