DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12477 and mkrn3

DIOPT Version :9

Sequence 1:NP_649055.1 Gene:CG12477 / 40040 FlyBaseID:FBgn0036809 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001135584.1 Gene:mkrn3 / 100216134 XenbaseID:XB-GENE-5958700 Length:370 Species:Xenopus tropicalis


Alignment Length:306 Identity:77/306 - (25%)
Similarity:126/306 - (41%) Gaps:93/306 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 HVDTG-------VLP-VPSTNSPSSQIEQKGNEAIVPNYKAAT--------AGEQGEAQAG---- 54
            |..||       :|| ||..|.     .::|:|..||..|.:.        :|.:..|.|.    
 Frog    67 HYLTGRRVSEPCILPHVPEHNE-----ARRGSEPSVPPLKLSVEHKETLPPSGRENWALAAEFIP 126

  Fly    55 -----------------ATCTTVAVRPSGVATSADIVK-GSSSVSSHVQPSWRSSFARSQDKKCG 101
                             |:.:|:..|..|:.::..:.. .|...:|.:|      :.||:|..||
 Frog   127 RHSGLIRSVSSPTLQHEASISTLVKRCEGIKSTTSLKNLNSQKCTSDLQ------YERSRDVVCG 185

  Fly   102 ICFETIMEKEGGDKRFGILPSCNHVFCFQCICTWRHATQYAYQVTRACPECRVWSNFVCPSAFWV 166
            ||.:.:.||:..::.|||||:|:|.:|..||..||....:..:|.:.||:||:.|::..|:.:||
 Frog   186 ICMDKVYEKQVAERVFGILPNCSHAYCVGCIKRWRKTRDFQNEVIKGCPQCRIKSSYFIPNKYWV 250

  Fly   167 EEKVAKDQLINDHLAAMRARDCKYFKQGQGVCLFGNKCFYKHSIPN-----------------AD 214
            .:...|.:||....|......|::|.:|.|.|.|.::|.|.|.||:                 ..
 Frog   251 GDSAEKAKLIETFKAKTSKIRCRFFIRGNGHCPFKSECIYLHEIPSRHQQRKRREQRRRSASALT 315

  Fly   215 YVDVGLPTHALGLPIPSDFSGLGNCLILVPFPNMFFDDFSNSDDYD 260
            |      :|.:|                     ||.:||::.:|.|
 Frog   316 Y------SHLVG---------------------MFDEDFTDDEDID 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12477NP_649055.1 RING 99..153 CDD:238093 21/53 (40%)
mkrn3NP_001135584.1 YTH1 <9..>60 CDD:227416
zf-CCCH_4 14..33 CDD:375512
RING-HC_MKRN4 181..240 CDD:319646 24/58 (41%)
RING-HC finger (C3HC4-type) 184..236 CDD:319646 21/51 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1388677at2759
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11224
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.