DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and SLC25A27

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_004268.3 Gene:SLC25A27 / 9481 HGNCID:21065 Length:323 Species:Homo sapiens


Alignment Length:331 Identity:85/331 - (25%)
Similarity:148/331 - (44%) Gaps:66/331 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DEPEGLLP---RW------WFGGFASMCVAFAVAPIDIVKTHMQIQRQK---------------- 53
            :|.|.|||   ||      ...|.|:.....|..|:|:.||.:|:|.:.                
Human     5 EEEERLLPLTQRWPRASKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGDGARESAPYR 69

  Fly    54 ---RSILGTVKRIHSLKGYLGFYDGFSAAILRQMTSTNIHFIVYDTGKKMEYVD-RDSYLGK--- 111
               |:.||.::.    :|:|..:.|.:.||.|.        :||..|:.:.|.. |:...||   
Human    70 GMVRTALGIIEE----EGFLKLWQGVTPAIYRH--------VVYSGGRMVTYEHLREVVFGKSED 122

  Fly   112 --------IILGCVAGACGSAFGIPTDLINVRMQTDMKE----PPYKRRNYKHVFDGLIRIPKEE 164
                    :|.|.:||..|.....||||:.|:||.:.|.    .|.:.|...|.|   .:|..|.
Human   123 EHYPLWKSVIGGMMAGVIGQFLANPTDLVKVQMQMEGKRKLEGKPLRFRGVHHAF---AKILAEG 184

  Fly   165 GWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISVNDGLPLHFLTSLGTSIISSAITHPL 229
            |.:.|:.|....:.:::|.....:..||.:|..:..|..:.|.:..|.|:||.:.:::|.:..|.
Human   185 GIRGLWAGWVPNIQRAALVNMGDLTTYDTVKHYLVLNTPLEDNIMTHGLSSLCSGLVASILGTPA 249

  Fly   230 DVVRTIMMNS-RPGEFR-TVFQASVHMMRFGVMGP-----YRGFVPTIVRKAPATTLLFVLYEQL 287
            ||:::.:||. |..:.| .::::|...:...|.|.     |:||:|:.:|..|.:.:.::.||::
Human   250 DVIKSRIMNQPRDKQGRGLLYKSSTDCLIQAVQGEGFMSLYKGFLPSWLRMTPWSMVFWLTYEKI 314

  Fly   288 RLHFGI 293
            |...|:
Human   315 REMSGV 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 76/303 (25%)
Mito_carr 26..100 CDD:278578 21/92 (23%)
Mito_carr 104..201 CDD:278578 29/112 (26%)
Mito_carr 211..292 CDD:278578 24/87 (28%)
SLC25A27NP_004268.3 Mito_carr 20..118 CDD:365909 23/109 (21%)
Solcar 1 21..115 23/105 (22%)
Mito_carr 125..219 CDD:365909 26/96 (27%)
Solcar 2 125..217 26/94 (28%)
Solcar 3 226..317 25/90 (28%)
Mito_carr 227..317 CDD:365909 24/89 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.