DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and DIC1

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_013452.1 Gene:DIC1 / 851063 SGDID:S000004340 Length:298 Species:Saccharomyces cerevisiae


Alignment Length:287 Identity:90/287 - (31%)
Similarity:140/287 - (48%) Gaps:33/287 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 WWFGGFASMCVAFAVAPIDIVKTHMQ-IQRQKRSILGTVKRIHSLKGYLGFYDGFSAAILRQMTS 86
            ||:||.|.:.......|:|:.|..:| ....|.::...::.|.:.:|.:|.|.|.|||:|||.|.
Yeast    17 WWYGGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFRMLESILANEGVVGLYSGLSAAVLRQCTY 81

  Fly    87 TNIHFIVYDTGKK----MEYVDRDSYLGKIILGC--VAGACGSAFGIPTDLINVRMQTDMKEPPY 145
            |.:.|..||..|:    .|.:...:||    |.|  .:||.|...|...|::|:|||.|......
Yeast    82 TTVRFGAYDLLKENVIPREQLTNMAYL----LPCSMFSGAIGGLAGNFADVVNIRMQNDSALEAA 142

  Fly   146 KRRNYKHVFDGLIRIPK-EEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKT--------EVRKN 201
            ||||||:..||:.:|.: |.|.|.|:.|....:.:..|.|.||:..||:.|.        :..||
Yeast   143 KRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTYDVFKNYLVTKLDFDASKN 207

  Fly   202 ISVNDGLPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTVFQASVHMMRFGVMGP---Y 263
            .:       |...||...::::.:..|.||::|.:||. .|:.:...:.....:|  ..||   :
Yeast   208 YT-------HLTASLLAGLVATTVCSPADVMKTRIMNG-SGDHQPALKILADAVR--KEGPSFMF 262

  Fly   264 RGFVPTIVRKAPATTLLFVLYEQLRLH 290
            ||::|:..|..|.|.|:|...|||:.|
Yeast   263 RGWLPSFTRLGPFTMLIFFAIEQLKKH 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 86/280 (31%)
Mito_carr 26..100 CDD:278578 25/78 (32%)
Mito_carr 104..201 CDD:278578 35/107 (33%)
Mito_carr 211..292 CDD:278578 25/83 (30%)
DIC1NP_013452.1 Mito_carr 20..94 CDD:395101 24/73 (33%)
Mito_carr 100..200 CDD:395101 36/103 (35%)
Mito_carr 203..289 CDD:395101 26/95 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346160
Domainoid 1 1.000 84 1.000 Domainoid score I1910
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I828
Isobase 1 0.950 - 0 Normalized mean entropy S759
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002037
OrthoInspector 1 1.000 - - otm46877
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.800

Return to query results.
Submit another query.