DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and ucp1

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_955817.1 Gene:ucp1 / 83908 ZFINID:ZDB-GENE-010503-1 Length:309 Species:Danio rerio


Alignment Length:291 Identity:89/291 - (30%)
Similarity:146/291 - (50%) Gaps:19/291 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DEPEGLLPRWWFGGFASMCVAFAVA-PIDIVKTHMQIQRQK-----------RSILGTVKRIHSL 66
            |.|..|..:....|.|: |:|..|. |:|..|..:|||.:|           :.:.||:..:...
Zfish     8 DVPPPLTVKVLSAGTAA-CIADLVTFPLDTAKVRLQIQGEKAVTGAAKGIRYKGVFGTISTMMRT 71

  Fly    67 KGYLGFYDGFSAAILRQMTSTNIHFIVYDTGKKMEYV---DRDSYLGKIILGCVAGACGSAFGIP 128
            :|....|:|..|.:.|||...:|...:||..|.. |.   |..:...:|:.||..||...:...|
Zfish    72 EGPRSLYNGLVAGLQRQMAFASIRIGLYDNVKSF-YTRGKDNPNVAVRILAGCTTGAMAVSMAQP 135

  Fly   129 TDLINVRMQTDMKEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDI 193
            ||::.||.|..|......|| |........:|.:.||.:.|:||....:.:::|..|:::..||:
Zfish   136 TDVVKVRFQAQMNLQGVGRR-YNGTMQAYRQIFQLEGLRGLWKGTLPNITRNALVNCTELVSYDL 199

  Fly   194 IKTEVRKNISVNDGLPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTVFQASVHMM-RF 257
            ||..:.|:..::|.||.||:::.|...|::.|..|:|||:|..|||.||::.:....:..|: :.
Zfish   200 IKEAILKHRLLSDNLPCHFVSAFGAGFITTVIASPVDVVKTRYMNSPPGQYSSSTNCAWTMLTKE 264

  Fly   258 GVMGPYRGFVPTIVRKAPATTLLFVLYEQLR 288
            |....|:||||:.:|......::||.:|||:
Zfish   265 GPTAFYKGFVPSFLRLGSWNVVMFVSFEQLK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 85/277 (31%)
Mito_carr 26..100 CDD:278578 25/85 (29%)
Mito_carr 104..201 CDD:278578 28/96 (29%)
Mito_carr 211..292 CDD:278578 28/79 (35%)
ucp1NP_955817.1 Mito_carr 10..110 CDD:395101 28/101 (28%)
Mito_carr 111..208 CDD:395101 29/97 (30%)
Mito_carr 213..299 CDD:395101 30/83 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.