DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and UCP2

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_568894.1 Gene:UCP2 / 836014 AraportID:AT5G58970 Length:305 Species:Arabidopsis thaliana


Alignment Length:284 Identity:75/284 - (26%)
Similarity:124/284 - (43%) Gaps:25/284 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 MCVAFAVA-------PIDIVKTHMQIQR-----------QKRSILGTVKRIHSLKGYLGFYDGFS 77
            :|.|||..       |:|..|..:|:||           :.|..:||:..|...:|..|.:.|..
plant    17 ICSAFAACFAELCTIPLDTAKVRLQLQRKIPTGDGENLPKYRGSIGTLATIAREEGISGLWKGVI 81

  Fly    78 AAILRQMTSTNIHFIVYDTGKKM----EYVDRDSYLGKIILGCVAGACGSAFGIPTDLINVRMQT 138
            |.:.||.....:...:|:..|.:    :::.......||:...:.||.......||||:.||:|:
plant    82 AGLHRQCIYGGLRIGLYEPVKTLLVGSDFIGDIPLYQKILAALLTGAIAIIVANPTDLVKVRLQS 146

  Fly   139 DMKEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNIS 203
            :.|.|....|.|....|....|.|.||..||:.|....:.::::...:::|.||.||..:.|...
plant   147 EGKLPAGVPRRYAGAVDAYFTIVKLEGVSALWTGLGPNIARNAIVNAAELASYDQIKETIMKIPF 211

  Fly   204 VNDGLPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTVFQASVHMMRF-GVMGPYRGFV 267
            ..|.:..|.|..|.....:..|..|:|||::.||..  ..:|......:..|:. |:|..|:||:
plant   212 FRDSVLTHLLAGLAAGFFAVCIGSPIDVVKSRMMGD--STYRNTVDCFIKTMKTEGIMAFYKGFL 274

  Fly   268 PTIVRKAPATTLLFVLYEQLRLHF 291
            |...|......::|:..||::..|
plant   275 PNFTRLGTWNAIMFLTLEQVKKVF 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 74/279 (27%)
Mito_carr 26..100 CDD:278578 22/86 (26%)
Mito_carr 104..201 CDD:278578 28/96 (29%)
Mito_carr 211..292 CDD:278578 23/82 (28%)
UCP2NP_568894.1 PTZ00169 11..296 CDD:240302 74/280 (26%)
Mito_carr 212..300 CDD:395101 24/89 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.