DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and DIC2

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_194188.1 Gene:DIC2 / 828559 AraportID:AT4G24570 Length:313 Species:Arabidopsis thaliana


Alignment Length:302 Identity:90/302 - (29%)
Similarity:150/302 - (49%) Gaps:42/302 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GGFASMCVAFAVAPIDIVKTHMQIQRQKRS--------------------ILGTVKRIHSL---- 66
            ||.||:....:..|:|::|..:|:..:..|                    .|.|...:..:    
plant     9 GGIASVIAGCSTHPLDLIKVRLQLHGEAPSTTTVTLLRPALAFPNSSPAAFLETTSSVPKVGPIS 73

  Fly    67 --------KGYLGFYDGFSAAILRQMTSTNIHFIVYDTGKKMEYVDRDSYLGKIIL------GCV 117
                    :|....:.|.||.:|||...:.....:|:. .|.::.|.:|  ||:.|      |.|
plant    74 LGINIVKSEGAAALFSGVSATLLRQTLYSTTRMGLYEV-LKNKWTDPES--GKLNLSRKIGAGLV 135

  Fly   118 AGACGSAFGIPTDLINVRMQTDMKEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSL 182
            ||..|:|.|.|.|:..||||.|.:.|..:||||..|.|.:..:.|.||..:|::|.::.:.::.:
plant   136 AGGIGAAVGNPADVAMVRMQADGRLPLAQRRNYAGVGDAIRSMVKGEGVTSLWRGSALTINRAMI 200

  Fly   183 STCSQIAFYDIIKTEVRKNISVNDGLPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTV 247
            .|.:|:|.||..|..:.:|..:||||..|.:.|.....::|..::|:||::|.:||.:.|.:...
plant   201 VTAAQLASYDQFKEGILENGVMNDGLGTHVVASFAAGFVASVASNPVDVIKTRVMNMKVGAYDGA 265

  Fly   248 FQASVHMMRF-GVMGPYRGFVPTIVRKAPATTLLFVLYEQLR 288
            :..:|..::. |.|..|:|||||:.|:.|.|.:|||..||:|
plant   266 WDCAVKTVKAEGAMALYKGFVPTVCRQGPFTVVLFVTLEQVR 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 89/300 (30%)
Mito_carr 26..100 CDD:278578 19/105 (18%)
Mito_carr 104..201 CDD:278578 37/102 (36%)
Mito_carr 211..292 CDD:278578 28/79 (35%)
DIC2NP_194188.1 Mito_carr 3..118 CDD:395101 20/109 (18%)
Mito_carr 122..220 CDD:395101 35/97 (36%)
Mito_carr 225..312 CDD:395101 30/83 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.