DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and PUMP1

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_190979.1 Gene:PUMP1 / 824578 AraportID:AT3G54110 Length:306 Species:Arabidopsis thaliana


Alignment Length:295 Identity:80/295 - (27%)
Similarity:132/295 - (44%) Gaps:29/295 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CVAFAVA-------PIDIVKTHMQIQR----------QKRSILGTVKRIHSLKGYLGFYDGFSAA 79
            |.|||..       |:|..|..:|:|:          :.|.:||||..|...:|....:.|....
plant    17 CSAFAACVGEVCTIPLDTAKVRLQLQKSALAGDVTLPKYRGLLGTVGTIAREEGLRSLWKGVVPG 81

  Fly    80 ILRQMTSTNIHFIVYDTGKKMEYVDRDSYLG------KIILGCVAGACGSAFGIPTDLINVRMQT 138
            :.||.....:...:|:..|.: ||.:| ::|      ||:.|...||.|.....||||:.||:|.
plant    82 LHRQCLFGGLRIGMYEPVKNL-YVGKD-FVGDVPLSKKILAGLTTGALGIMVANPTDLVKVRLQA 144

  Fly   139 DMKEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNIS 203
            :.|......|.|....:....|.::||.:||:.|....|.::::...:::|.||.:|..:.|...
plant   145 EGKLAAGAPRRYSGALNAYSTIVRQEGVRALWTGLGPNVARNAIINAAELASYDQVKETILKIPG 209

  Fly   204 VNDGLPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTVFQASVHMMRF-GVMGPYRGFV 267
            ..|.:..|.|:.||....:..|..|:|||::.||.. .|.::......|..::. |.|..|:||:
plant   210 FTDNVVTHILSGLGAGFFAVCIGSPVDVVKSRMMGD-SGAYKGTIDCFVKTLKSDGPMAFYKGFI 273

  Fly   268 PTIVRKAPATTLLFVLYEQLRLHFGICSLGGEKYN 302
            |...|......::|:..||.:.:  :..|...|.|
plant   274 PNFGRLGSWNVIMFLTLEQAKKY--VRELDASKRN 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 77/279 (28%)
Mito_carr 26..100 CDD:278578 21/84 (25%)
Mito_carr 104..201 CDD:278578 29/102 (28%)
Mito_carr 211..292 CDD:278578 23/81 (28%)
PUMP1NP_190979.1 Mito_carr 7..106 CDD:395101 23/89 (26%)
Mito_carr 110..206 CDD:395101 28/95 (29%)
Mito_carr 210..299 CDD:395101 24/91 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.