DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and UCP5

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_179836.1 Gene:UCP5 / 816783 AraportID:AT2G22500 Length:313 Species:Arabidopsis thaliana


Alignment Length:301 Identity:93/301 - (30%)
Similarity:151/301 - (50%) Gaps:36/301 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GGFASMCVAFAVAPIDIVKTHMQIQRQ-------------------------KRSILGTVKRIHS 65
            ||.||:....:..|:|::|..||:|.:                         :..::|...|:..
plant     9 GGIASIVAGCSTHPLDLIKVRMQLQGESAPIQTNLRPALAFQTSTTVNAPPLRVGVIGVGSRLIR 73

  Fly    66 LKGYLGFYDGFSAAILRQMTSTNIHFIVYDTGKKMEYVDRDS----YLGKIILGCVAGACGSAFG 126
            .:|....:.|.||.:|||...:.....:||. .|.|:.|.::    .:.||..|.:|||.|:|.|
plant    74 EEGMRALFSGVSATVLRQTLYSTTRMGLYDI-IKGEWTDPETKTMPLMKKIGAGAIAGAIGAAVG 137

  Fly   127 IPTDLINVRMQTDMKEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFY 191
            .|.|:..||||.|.:.|...|||||.|.|.:.::.:.||..:|::|.|:.:.::.|.|.||:|.|
plant   138 NPADVAMVRMQADGRLPLTDRRNYKSVLDAITQMIRGEGVTSLWRGSSLTINRAMLVTSSQLASY 202

  Fly   192 DIIKTEVRKNISVNDGLPLHFLTSLGTSIISSAITHPLDVVRTIMMNSR------PGEFRTVFQA 250
            |.:|..:.:...:.|||..|...|.....::|..::|:||::|.:||.:      |.....|..|
plant   203 DSVKETILEKGLLKDGLGTHVSASFAAGFVASVASNPVDVIKTRVMNMKVVAGVAPPYKGAVDCA 267

  Fly   251 SVHMMRFGVMGPYRGFVPTIVRKAPATTLLFVLYEQLRLHF 291
            ...:...|:|..|:||:||:.|:||.|.:|||..||::..|
plant   268 LKTVKAEGIMSLYKGFIPTVSRQAPFTVVLFVTLEQVKKLF 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 92/296 (31%)
Mito_carr 26..100 CDD:278578 21/98 (21%)
Mito_carr 104..201 CDD:278578 38/100 (38%)
Mito_carr 211..292 CDD:278578 29/87 (33%)
UCP5NP_179836.1 Mito_carr 3..106 CDD:395101 21/97 (22%)
Mito_carr <136..213 CDD:395101 29/76 (38%)
Mito_carr 216..311 CDD:395101 32/93 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.