DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and ucp3

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_956647.2 Gene:ucp3 / 794081 ZFINID:ZDB-GENE-040426-1317 Length:309 Species:Danio rerio


Alignment Length:281 Identity:81/281 - (28%)
Similarity:143/281 - (50%) Gaps:18/281 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 WFGGFASMCVAFAVA-PIDIVKTHMQIQRQK-----------RSILGTVKRIHSLKGYLGFYDGF 76
            :||...:.|.|..|. |:|..|..:|||.:.           |.:.||:..:...:|....|:|.
Zfish    17 FFGAGTAACFADLVTFPLDTAKVRLQIQGESGTAPGSAVLKYRGVFGTITTMVRTEGARSLYNGL 81

  Fly    77 SAAILRQMTSTNIHFIVYDTGKKMEYV---DRDSYLGKIILGCVAGACGSAFGIPTDLINVRMQT 138
            .|.:.|||:..::...:||:.|:. |.   :..|.:.:::.||..||...||..|||::.||.|.
Zfish    82 VAGLQRQMSFASVRIGLYDSMKQF-YTRGSENASIVTRLLAGCTTGAMAVAFAQPTDVVKVRFQA 145

  Fly   139 DMKEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNIS 203
            .::.....:| |....|....|.::||.:.|:||....:.::::..|:::..|||||..:.|...
Zfish   146 QVRHTDGGKR-YNGTMDAYRTIARDEGVRGLWKGCMPNITRNAIVNCAELVTYDIIKDLILKYDL 209

  Fly   204 VNDGLPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTVFQASVHMM-RFGVMGPYRGFV 267
            :.|.||.||..:.|....::.:..|:|||:|..|||..|::.:....::.|: :.|....|:||:
Zfish   210 MTDNLPCHFTAAFGAGFCTTIVASPVDVVKTRFMNSSAGQYGSALNCALMMLTKEGPAAFYKGFM 274

  Fly   268 PTIVRKAPATTLLFVLYEQLR 288
            |:.:|......::||.|||::
Zfish   275 PSFLRLGSWNIVMFVSYEQIK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 80/277 (29%)
Mito_carr 26..100 CDD:278578 23/85 (27%)
Mito_carr 104..201 CDD:278578 28/96 (29%)
Mito_carr 211..292 CDD:278578 24/79 (30%)
ucp3NP_956647.2 Mito_carr 10..110 CDD:278578 25/93 (27%)
PTZ00169 14..298 CDD:240302 81/281 (29%)
Mito_carr 114..207 CDD:278578 28/93 (30%)
Mito_carr 211..301 CDD:278578 27/85 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.