DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and UCP2

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_024304442.1 Gene:UCP2 / 7351 HGNCID:12518 Length:310 Species:Homo sapiens


Alignment Length:298 Identity:84/298 - (28%)
Similarity:145/298 - (48%) Gaps:36/298 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GDCHDEPEGLLPRW-WFGGFASMCVAFAVAPIDIVKTHMQIQ------------RQKRSILGTVK 61
            |.|.:..:.    | |.|..|..|....:|        :|||            .|.|.::||:.
Human    16 GQCLEHRDD----WRWEGQHAYPCSYPVLA--------LQIQGESQGPVRATASAQYRGVMGTIL 68

  Fly    62 RIHSLKGYLGFYDGFSAAILRQMTSTNIHFIVYDTGKKMEYV---DRDSYLGKIILGCVAGACGS 123
            .:...:|....|:|..|.:.|||:..::...:||:.|:. |.   :..|...:::.|...||...
Human    69 TMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQF-YTKGSEHASIGSRLLAGSTTGALAV 132

  Fly   124 AFGIPTDLINVRMQTDMKEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQI 188
            |...|||::.||.|...:....:|  |:...:....|.:|||::.|:||.|..|.::::..|:::
Human   133 AVAQPTDVVKVRFQAQARAGGGRR--YQSTVNAYKTIAREEGFRGLWKGTSPNVARNAIVNCAEL 195

  Fly   189 AFYDIIKTEVRKNISVNDGLPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTVFQASVH 253
            ..||:||..:.|...:.|.||.||.::.|....::.|..|:|||:|..|||..|::.:....::.
Human   196 VTYDLIKDALLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSALGQYSSAGHCALT 260

  Fly   254 MMRFGVMGP---YRGFVPTIVRKAPATTLLFVLYEQLR 288
            |::  ..||   |:||:|:.:|......::||.||||:
Human   261 MLQ--KEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLK 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 79/279 (28%)
Mito_carr 26..100 CDD:278578 21/85 (25%)
Mito_carr 104..201 CDD:278578 27/96 (28%)
Mito_carr 211..292 CDD:278578 27/81 (33%)
UCP2XP_024304442.1 Mito_carr <42..112 CDD:332982 18/70 (26%)
Mito_carr 113..207 CDD:278578 27/95 (28%)
Mito_carr 218..300 CDD:278578 27/81 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.