DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and UCP1

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_068605.1 Gene:UCP1 / 7350 HGNCID:12517 Length:307 Species:Homo sapiens


Alignment Length:279 Identity:77/279 - (27%)
Similarity:143/279 - (51%) Gaps:18/279 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FGGFASMCVAFAVA-PIDIVKTHMQIQRQ--------KRSILGTVKRIHSLKGYLGFYDGFSAAI 80
            |....:.|:|..:. |:|..|..:|:|.:        .:.:|||:..:...:|.:..|.|..|.:
Human    18 FSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGL 82

  Fly    81 LRQMTSTNIHFIVYDTGKKMEYVDRDS--YLG-KIILGCVAGACGSAFGIPTDLINVRMQTDMKE 142
            .||::|.::...:|||.::.....:::  .|| ||:.|...|......|.||:::.||:|.....
Human    83 QRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHL 147

  Fly   143 PPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISVNDG 207
            ...|.| |...::....|...||...|:||.:..:.:|.:..|:::..||::|....||..:.|.
Human   148 HGIKPR-YTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADD 211

  Fly   208 LPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTVFQASVHMMRFGVMGP---YRGFVPT 269
            :|.|.:::|.....::|::.|:|||:|..:||.||::::|  .:..|..|...||   ::|.||:
Human   212 VPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSV--PNCAMKVFTNEGPTAFFKGLVPS 274

  Fly   270 IVRKAPATTLLFVLYEQLR 288
            .:|......::||.:|||:
Human   275 FLRLGSWNVIMFVCFEQLK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 75/276 (27%)
Mito_carr 26..100 CDD:278578 20/82 (24%)
Mito_carr 104..201 CDD:278578 26/99 (26%)
Mito_carr 211..292 CDD:278578 26/81 (32%)
UCP1NP_068605.1 Mito_carr 10..104 CDD:278578 21/85 (25%)
Solcar 1 11..102 21/83 (25%)
Mito_carr 111..206 CDD:278578 27/95 (28%)
Solcar 2 111..201 26/90 (29%)
Solcar 3 210..295 28/86 (33%)
Mito_carr 215..300 CDD:278578 26/81 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.