DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and Slc25a30

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_006519518.1 Gene:Slc25a30 / 67554 MGIID:1914804 Length:311 Species:Mus musculus


Alignment Length:260 Identity:70/260 - (26%)
Similarity:123/260 - (47%) Gaps:31/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FGGFASMCVAFAVAPIDIVKTHMQIQRQK----------RSILGTVKRIHSLKGYLGFYDGFSAA 79
            :||.||:.......|||:.||.:|||.|.          |.:|..:.||...:|....|.|.:.|
Mouse    11 YGGLASITAECGTFPIDLTKTRLQIQGQTNDANFREIRYRGMLHALMRIGREEGLKALYSGIAPA 75

  Fly    80 ILRQMTSTNIHFIVYDTGKKM--EYVDRDSYLGKIILGCVAGACGSAFGIPTDLINVRMQTDMKE 142
            :|||.:...|....|.:.|::  |..:.::.|..::.|.::|...||...|||::.:|||..   
Mouse    76 MLRQASYGTIKIGTYQSLKRLAVERPEDETLLVNVVCGILSGVISSAIANPTDVLKIRMQAQ--- 137

  Fly   143 PPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISVNDG 207
               .......:.|..:.|.::||.:.|:||.|:...::::....::..|||.|..:..:..:.|.
Mouse   138 ---NSAVQGGMIDSFMSIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGDT 199

  Fly   208 LPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTVFQASVHMMRFGVMGPYRGFVPTIVR 272
            :..|||:|....::.:..::|:|||||.|||.|             .:|.|....|:|.:..:::
Mouse   200 VATHFLSSFTCGLVGALASNPVDVVRTRMMNQR-------------ALRDGRCAGYKGTLDCLLQ 251

  Fly   273  272
            Mouse   252  251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 70/259 (27%)
Mito_carr 26..100 CDD:278578 27/83 (33%)
Mito_carr 104..201 CDD:278578 23/96 (24%)
Mito_carr 211..292 CDD:278578 18/62 (29%)
Slc25a30XP_006519518.1 Mito_carr 6..96 CDD:365909 27/84 (32%)
Mito_carr 105..191 CDD:365909 23/91 (25%)
Mito_carr 199..>259 CDD:365909 18/66 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.