DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and slc25a10

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001017018.1 Gene:slc25a10 / 549772 XenbaseID:XB-GENE-955175 Length:286 Species:Xenopus tropicalis


Alignment Length:281 Identity:102/281 - (36%)
Similarity:160/281 - (56%) Gaps:5/281 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EGLLPRWWFGGFASMCVAFAVAPIDIVKTHMQIQRQ-KRSILGTVKRIHSLKGYLGFYDGFSAAI 80
            |..:.||:|||.||...|....|:|::|.|:|.|:: |..:.|....:....|:|..|:|.||::
 Frog     3 ERRVSRWYFGGLASCGAACCTHPLDLIKVHLQTQQEVKMRMTGMAISVIRNDGFLALYNGLSASL 67

  Fly    81 LRQMTSTNIHFIVYDTGKKMEYVDRDS---YLGKIILGCVAGACGSAFGIPTDLINVRMQTDMKE 142
            .||:|.:...|.:|:|.:.....|..:   :..|::||.|.|..|...|.|.|::|||||.|:|.
 Frog    68 FRQITYSLTRFAIYETARDRLMQDNKAPLPFYQKVLLGAVGGFTGGFIGTPADMVNVRMQNDVKL 132

  Fly   143 PPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISVNDG 207
            |.:.||||.|..||:.|:.:|||::.|:.|.::|..:.:|.|..|:|.||..|..|.....::|.
 Frog   133 PAHLRRNYAHALDGMFRVIREEGFRKLFSGATMASSRGALVTVGQLACYDQAKQLVLNTGFLSDN 197

  Fly   208 LPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTVFQASVHMMRFGVMGPYRGFVPTIVR 272
            :..|||.|......::.:..||||::|.:||:: ||:|.|...::...:.|.:..|:|.||..:|
 Frog   198 IFTHFLASSIAGGCATFLCQPLDVLKTRLMNAK-GEYRGVVHCTLETAKLGPLAFYKGLVPAGIR 261

  Fly   273 KAPATTLLFVLYEQLRLHFGI 293
            ..|.|.|.||..||||.:||:
 Frog   262 LIPHTVLTFVFLEQLRKYFGV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 94/265 (35%)
Mito_carr 26..100 CDD:278578 25/74 (34%)
Mito_carr 104..201 CDD:278578 40/99 (40%)
Mito_carr 211..292 CDD:278578 30/80 (38%)
slc25a10NP_001017018.1 Mito_carr 12..89 CDD:365909 25/76 (33%)
Mito_carr 96..190 CDD:365909 39/93 (42%)
Mito_carr 197..281 CDD:365909 30/84 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 1 1.000 - - FOG0002037
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.