DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and CG7943

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster


Alignment Length:306 Identity:70/306 - (22%)
Similarity:128/306 - (41%) Gaps:50/306 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFDDHFLGDCHDEPEGLLPRWWFGGFASMCVAFAVAPIDIVKTHMQIQRQKRSILGTV------- 60
            ||...|.|....|.           ||..|.|   |.::|..|:...:...|.:|..|       
  Fly    43 VFSKRFFGSFQWEE-----------FACGCGA---AFVNIAVTYPIYKMIFRQMLHGVPITSAFA 93

  Fly    61 KRIHSLKGYLGFYDGFSAAILRQMTSTNIHFIVYDTGKKMEYVDRD----SYLGKIILGCVAGAC 121
            :..|...|:|  |.|....:.::..|.:|.|.|:|..::  |:..|    .|..|::...|||:.
  Fly    94 QLRHEGLGFL--YRGMLPPLAQKTISLSIMFGVFDGTRR--YLVEDYRLNDYGAKVLAAVVAGSA 154

  Fly   122 GSAFGIPTDLINVRMQTDMKEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCS 186
            .|.. :|.:    |:||.:.:..: .:::.:..:....:....|::.||:|.....:::.||.  
  Fly   155 ESIL-LPFE----RVQTLLADSKF-HQHFSNTQNAFRYVVSHHGYRELYRGLEPVFWRNGLSN-- 211

  Fly   187 QIAFYDIIKTE--VR--KNISVNDGLPLHFLTS--LGTSIISSAITHPLDVVRTIMMNSRPGEFR 245
              |.:.:::.|  ||  |..||:......|:..  :|.||  |.|.:||:|::..:.:.......
  Fly   212 --ALFFVLREEASVRLPKRKSVSTRTVQEFIAGAVIGASI--STIFYPLNVIKVSLQSEMGQRSE 272

  Fly   246 TVFQA--SVHMMRFGVMGP-YRGFVPTIVRKAPATTLLFVLYEQLR 288
            ..:||  .:::.|...:|. |||......|...:..::...||.|:
  Fly   273 GSWQACKRIYVERDRRIGNFYRGCPFNTGRSFISWGIMNTAYENLK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 64/281 (23%)
Mito_carr 26..100 CDD:278578 20/80 (25%)
Mito_carr 104..201 CDD:278578 21/104 (20%)
Mito_carr 211..292 CDD:278578 20/83 (24%)
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 22/99 (22%)
Mito_carr 141..229 CDD:278578 21/97 (22%)
Mito_carr 235..322 CDD:278578 20/86 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441889
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.