DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and CG1907

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster


Alignment Length:306 Identity:94/306 - (30%)
Similarity:155/306 - (50%) Gaps:39/306 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RWWFGGFASMCVAFAVAPIDIVKTHMQI------QRQKRSILGTVKRIHSLKGYLGFYDGFSAAI 80
            ::.|||.:.|.....|.|:|:|||.|||      :::.||.|..::.|.|.:|.|..|.|..||:
  Fly    20 KFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYRSSLHCIQTIVSKEGPLALYQGIGAAL 84

  Fly    81 LRQMTSTNIHFIVYDTGKKMEYVDRDSYLGKII---------------LGCVAGACGSAFGIPTD 130
            |||.|        |.||:...|    :||..:.               :|.:|||||:..|.|.:
  Fly    85 LRQAT--------YTTGRLGMY----TYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAE 137

  Fly   131 LINVRMQTDMKEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIK 195
            :..|||.:|.:.|..:||||.:|.:.|.||.:|||..||::|....|.::.:...:|:|.|...|
  Fly   138 VALVRMTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFK 202

  Fly   196 TEVRKN-ISVNDGLPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTVFQASVHMM---- 255
            |..|.. :.:.:|:.|||..|:.:.::::..:.|||:.:|.:.|.:..:.:..::.:..::    
  Fly   203 TYFRHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGTADVLLRVA 267

  Fly   256 -RFGVMGPYRGFVPTIVRKAPATTLLFVLYEQLRLHFGICSLGGEK 300
             :.||...::||.|...|..|.|.|.|::.|||...:....||..|
  Fly   268 RQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQGYNKYVLGSNK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 89/288 (31%)
Mito_carr 26..100 CDD:278578 30/79 (38%)
Mito_carr 104..201 CDD:278578 36/111 (32%)
Mito_carr 211..292 CDD:278578 21/85 (25%)
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 34/100 (34%)
Mito_carr 118..207 CDD:278578 33/88 (38%)
Mito_carr 219..307 CDD:278578 21/87 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441901
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.