DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and CG4743

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster


Alignment Length:281 Identity:70/281 - (24%)
Similarity:112/281 - (39%) Gaps:51/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GGFASMCVAFAVAPIDIVKTHMQIQRQKRSILGTVKRIHSLKGYLGFYDGFSAAILRQMTSTNIH 90
            ||.|.|.|..|:.|||.|||.:|      |.||    .....|:.|.|.|.:.|......:..:.
  Fly    34 GGVAGMVVDIALFPIDTVKTRLQ------SELG----FWRAGGFRGIYKGLAPAAAGSAPTAALF 88

  Fly    91 FIVYDTGKKM----------EYVDRDSYLGKIILGCVAGACGSAFGIPTDLINVRMQTDMKEPPY 145
            |..|:.||:.          .||...:.....:|.|:       ..:|.::...|.||       
  Fly    89 FCTYECGKQFLSSVTQTKDSPYVHMAAASAAEVLACL-------IRVPVEIAKQRSQT------- 139

  Fly   146 KRRNYKHVFDGLIRIPKEEGWK-ALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISVNDGLP 209
            .:.|.:.....|:|..:.||.| .||:|....:.:....:..|...::..|.:... ::..|..|
  Fly   140 LQGNKQSGLQILLRAYRTEGLKRGLYRGFGSTIMREIPFSLIQFPLWEYFKLQWTP-LTGFDSTP 203

  Fly   210 LHFLTSLGTSI---ISSAITHPLDVVRTIMM-------NSRPGEFRTVFQASVHMMRFGVMGPYR 264
              |..:|..::   ||:.:|.|||||:|.:|       |.|....|.:.  .:::.| |..|.:.
  Fly   204 --FSVALCGAVAGGISAGLTTPLDVVKTRIMLAERESLNRRRSARRILH--GIYLER-GFSGLFA 263

  Fly   265 GFVPTIVRKAPATTLLFVLYE 285
            ||||.::.........|..|:
  Fly   264 GFVPRVLWITLGGAFFFGFYD 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 70/281 (25%)
Mito_carr 26..100 CDD:278578 25/73 (34%)
Mito_carr 104..201 CDD:278578 17/97 (18%)
Mito_carr 211..292 CDD:278578 24/85 (28%)
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 25/74 (34%)
PTZ00168 25..281 CDD:185494 68/276 (25%)
Mito_carr 199..291 CDD:278578 26/91 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441871
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.