DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and GC2

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster


Alignment Length:191 Identity:47/191 - (24%)
Similarity:81/191 - (42%) Gaps:32/191 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FDDHFLGDCHDEPEGLLP---RWWFGGFASMCVAFAVAPIDIVKTHMQ-----------IQRQKR 54
            |..|...|     :|::|   ....||.|.:.......|::::|..||           ..|:.:
  Fly   105 FRYHLASD-----DGVIPLSRATLAGGLAGLFQIVVTTPMELLKIQMQDAGRVAAADRAAGREVK 164

  Fly    55 SI--LGTVKRIHSLKGYLGFYDGFSAAILRQMTSTNIHF----IVYDTG-KKMEYVDRDSYLGKI 112
            :|  ||..|.:...:|..|.|.|..|..:|.:|.:.::|    .:.|.| :|.:......:...:
  Fly   165 TITALGLTKTLLRERGIFGLYKGVGATGVRDITFSMVYFPLMAWINDQGPRKSDGSGEAVFYWSL 229

  Fly   113 ILGCVAGACGSAFGIPTDLINVRMQTDMKEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGG 173
            |.|.::|...:....|.|::..|:|.|      ..:.:|.:.|.:.|..||||..|.:|||
  Fly   230 IAGLLSGMTSAFMVTPFDVVKTRLQAD------GEKKFKGIMDCVNRTLKEEGISAFFKGG 284

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 42/166 (25%)
Mito_carr 26..100 CDD:278578 22/91 (24%)
Mito_carr 104..201 CDD:278578 19/70 (27%)
Mito_carr 211..292 CDD:278578
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 47/191 (25%)