DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and GC1

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster


Alignment Length:317 Identity:74/317 - (23%)
Similarity:118/317 - (37%) Gaps:76/317 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLPRWWFGGFASMCVAFAVAPIDIVKTHMQIQ-------RQKRSILGTVKRIHSLKGYLGFYDGF 76
            |||:...||.|.:.....|.|:|:|||.:|.|       |...|:....::.:..:||.|.|.| 
  Fly    21 LLPKIINGGIAGIIGVTCVFPLDLVKTRLQNQQIGPNGERMYNSMFDCFRKTYKAEGYFGMYRG- 84

  Fly    77 SAAILRQMTSTNIHFIVYDTGKKMEYVDRDSYL--------GKIIL--GCVAGACGSAFGI---- 127
                    :..||..|   |.:|...:..:.|.        ||:.|  ..|||....||.|    
  Fly    85 --------SGVNILLI---TPEKAIKLTANDYFRHKLTTKDGKLPLTSQMVAGGLAGAFQIIVTT 138

  Fly   128 PTDLINVRMQ--------TDMKEPPYKRRNYKHVFDGLIRIPKEEGWKALYKG-GSVAVFKSSLS 183
            |.:|:.::||        ..:.....::.:...:...||   |::|...|||| |:..:...:.|
  Fly   139 PMELLKIQMQDAGRVAAAAKLAGKTVEKVSATQLASQLI---KDKGIFGLYKGIGATGLRDVTFS 200

  Fly   184 TCSQIAFYDIIKTEVRKNISVNDG-----LPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPG- 242
                |.::.:..|........|||     ....||..|.....::...:|.|||:|.:...:.. 
  Fly   201 ----IIYFPLFATLNDLGPRRNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRLQAIKKAD 261

  Fly   243 ---EFRTV----------------FQASVHMMRFGVMGPYRGFVPTIVRKAPATTLL 280
               ||:.:                |:..  :.|..|:.|..|...|:.....|..||
  Fly   262 GEKEFKGISDCITKTLKHEGPTAFFKGG--LCRMIVIAPLFGIAQTVYYLGVAEGLL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 71/310 (23%)
Mito_carr 26..100 CDD:278578 22/80 (28%)
Mito_carr 104..201 CDD:278578 26/119 (22%)
Mito_carr 211..292 CDD:278578 19/90 (21%)
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 21/88 (24%)
Mito_carr 115..213 CDD:278578 25/104 (24%)
Mito_carr 226..307 CDD:278578 16/82 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441921
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.