DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and slc25a27

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_956635.1 Gene:slc25a27 / 393312 ZFINID:ZDB-GENE-040426-1290 Length:315 Species:Danio rerio


Alignment Length:310 Identity:93/310 - (30%)
Similarity:144/310 - (46%) Gaps:58/310 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SMCVAFAVA-----PIDIVKTHMQIQRQKRS--------------ILGTVKRIHSLKGYLGFYDG 75
            |.|.| |||     |:|:.||.:|||.:.||              :|.|...|...:|.|..:.|
Zfish    19 SACAA-AVAELVTFPLDLTKTRLQIQGEGRSGKNGGSVQTQKYRGMLSTAAGIVREEGPLKLWQG 82

  Fly    76 FSAAILRQMTSTNIHFIVYDTGKKMEYVD-RDSYLGK-----------IILGCVAGACGSAFGIP 128
            .:.||.|.        |||..|:.:.|.. |:|.|||           :|...::||.|.....|
Zfish    83 VTPAIYRH--------IVYSGGRMLAYEQMRESVLGKSEDGIFPVWKAVIASMISGALGQFIASP 139

  Fly   129 TDLINVRMQTDMK-----EPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQI 188
            |||:.|:||.:.:     :||..|..| |.|   .:|..:.|.:.|:.|....|.:::|.....:
Zfish   140 TDLVKVQMQMEGRRRLEGKPPRVRGVY-HAF---TKIVAQGGIRGLWAGWVPNVQRAALVNLGDL 200

  Fly   189 AFYDIIKTEVRKNISVNDGLPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGE-------FRT 246
            ..||.:|..:.:|.|:.|....|.|:|:.:.::::.:..|.|||:|.:|| :|.:       :|.
Zfish   201 MTYDTVKHFLLRNTSIPDNSICHGLSSICSGLVAATMGTPADVVKTRVMN-QPRDSNGRGLLYRN 264

  Fly   247 VFQASVH-MMRFGVMGPYRGFVPTIVRKAPATTLLFVLYEQLRLHFGICS 295
            .....|. :.|.|....|:||:||..|.||.:...::.:||||...||.|
Zfish   265 STDCLVQSVRREGFFSLYKGFLPTWFRMAPWSLTFWLTFEQLRRAMGISS 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 88/301 (29%)
Mito_carr 26..100 CDD:278578 28/88 (32%)
Mito_carr 104..201 CDD:278578 31/113 (27%)
Mito_carr 211..292 CDD:278578 27/88 (31%)
slc25a27NP_956635.1 Mito_carr 13..112 CDD:278578 33/101 (33%)
PTZ00169 16..310 CDD:240302 90/304 (30%)
Mito_carr 118..213 CDD:278578 26/98 (27%)
Mito_carr 217..311 CDD:278578 28/94 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.