DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and Bmcp

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster


Alignment Length:298 Identity:86/298 - (28%)
Similarity:132/298 - (44%) Gaps:42/298 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FGGFASMCVAFAVAPIDIVKTHMQIQRQK----------RSILGTVKRIHSLKGYLGFYDGFSAA 79
            :||.||:...|...|||..||.:|||.||          |.:.....:|...:|....|.|...|
  Fly    12 YGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIWPA 76

  Fly    80 ILRQMTSTNIHFIVYDTGKKME-----YVDRDS---YLGKIILGCVAGACGSAFGIPTDLINVRM 136
            :|||.|...|.|..|.|.||:.     .::.|.   ....|:....|||..||...|||::.|||
  Fly    77 VLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTDVLKVRM 141

  Fly   137 QTDMKEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKN 201
            |.      :.:..:|.:......|.|.||.:.|::|......::.:....::..||..|.::.. 
  Fly   142 QV------HGKGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCKLQLMN- 199

  Fly   202 ISVNDGLPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGE---------------FRTVFQAS 251
             :..|.:..||::|...|:.|:..:.|:||:||.:||.||..               :......:
  Fly   200 -AFGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLYSGSLDCA 263

  Fly   252 VHMMR-FGVMGPYRGFVPTIVRKAPATTLLFVLYEQLR 288
            |..:| .|:...|:||:||.||..|...:.|:.||||:
  Fly   264 VQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 85/295 (29%)
Mito_carr 26..100 CDD:278578 30/83 (36%)
Mito_carr 104..201 CDD:278578 24/99 (24%)
Mito_carr 211..292 CDD:278578 30/94 (32%)
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 30/84 (36%)
Mito_carr <132..199 CDD:278578 17/72 (24%)
Mito_carr 204..303 CDD:278578 30/98 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441967
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.