DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and slc25a14

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_017208245.1 Gene:slc25a14 / 393133 ZFINID:ZDB-GENE-040426-749 Length:335 Species:Danio rerio


Alignment Length:285 Identity:75/285 - (26%)
Similarity:137/285 - (48%) Gaps:34/285 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FGGFASMCVAFAVAPIDIVKTHMQIQRQK-------RSILGTVKRIHSLKGYLGFYDGFSAAILR 82
            :||.||:...|...|||:.||.:|:|.|.       |.:...:.||...:|....|.|.|.|:||
Zfish    60 YGGMASIVAEFGTFPIDLTKTRLQVQGQTHCMEVRYRGMFHALLRIGREEGVRALYSGISPALLR 124

  Fly    83 QMTSTNIHFIVYDTGKKM--EYVDRDSYLGKIILGCVAGACGSAFGIPTDLINVRMQT------- 138
            |.:...|....|:|.||:  .:.:.::.:..:..|.|:|...|:...|||::.:|||.       
Zfish   125 QASYGTIKIGTYNTLKKLFVSHPEEETMVINVFCGVVSGVLSSSLANPTDVLKIRMQAQGSLLQG 189

  Fly   139 DMKEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNIS 203
            .|..      |:.:::       :.||.:.|::|......::::....::..|||.|..:.::..
Zfish   190 SMMS------NFMNIY-------QTEGTRGLWRGVIPTAQRAAIVVGVELPVYDITKKHLIRSGL 241

  Fly   204 VNDGLPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTVFQASVH-MMRF----GVMGPY 263
            :.|.:..||::|....:..:..::|:|||||.|||.|......:::.::. :|:.    |....|
Zfish   242 MGDTVLTHFISSFTCGLAGALASNPVDVVRTRMMNQRVLAGNPLYKGTLDGLMQTWRNEGFFALY 306

  Fly   264 RGFVPTIVRKAPATTLLFVLYEQLR 288
            :||.|..:|..|...:.|:.:|||:
Zfish   307 KGFWPNWLRLGPWNIIFFMTFEQLK 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 74/282 (26%)
Mito_carr 26..100 CDD:278578 28/80 (35%)
Mito_carr 104..201 CDD:278578 20/103 (19%)
Mito_carr 211..292 CDD:278578 25/83 (30%)
slc25a14XP_017208245.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.