DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and CG8323

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster


Alignment Length:295 Identity:74/295 - (25%)
Similarity:129/295 - (43%) Gaps:43/295 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GGFASMCVAFAVAPIDIVKTHMQIQRQ----------KRSILGTVKRIHSLKGYLGFYDGFSAAI 80
            ||.||:...|...||:::||.:|:|.:          .:.|:.....:....|..|...|.:.|:
  Fly     9 GGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKGLAPAL 73

  Fly    81 LRQMTSTNIHFIVYDTGKKMEYVDRD----SYLGKIILGCVAGACGSAFGIPTDLINVRMQTDMK 141
            ..|....:....:|....:..::...    ||...::.|.:.|..|..|..|..||..::|:...
  Fly    74 YFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMGLLWGAIGGVVGCYFSSPFFLIKTQLQSQAA 138

  Fly   142 EPPYKRRNYKH--VFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAF----------YDII 194
            :.......:.|  :.|.|.:|....|.:.|::|...|:.:::|.:.:|||.          ||::
  Fly   139 KQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKTKALLVQYDLV 203

  Fly   195 KTEVRKNISVNDGLPLHFLTSLGTSIISSAITHPLDVVRTIMMN------SRPGEFRTVFQASVH 253
             |:...| |.:.||       :..||:|.|||.| ||:.|.:.|      .|...:|......|.
  Fly   204 -TQPTLN-SFSAGL-------IAGSIMSVAITPP-DVITTRLYNQGVDAEGRGLLYRGWLDCFVK 258

  Fly   254 MMRF-GVMGPYRGFVPTIVRKAPATTLLFVLYEQL 287
            ::|. ||.|.|:||....:|.||.:||:.:.:::|
  Fly   259 ILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFDEL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 74/295 (25%)
Mito_carr 26..100 CDD:278578 18/83 (22%)
Mito_carr 104..201 CDD:278578 25/112 (22%)
Mito_carr 211..292 CDD:278578 27/84 (32%)
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 17/77 (22%)
PTZ00169 5..293 CDD:240302 73/293 (25%)
Mito_carr 101..200 CDD:278578 22/98 (22%)
Mito_carr 206..301 CDD:278578 31/97 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441310
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.