DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and Slc25a30

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001013205.1 Gene:Slc25a30 / 361074 RGDID:1359702 Length:291 Species:Rattus norvegicus


Alignment Length:290 Identity:82/290 - (28%)
Similarity:134/290 - (46%) Gaps:39/290 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FGGFASMCVAFAVAPIDIVKTHMQIQRQK----------RSILGTVKRIHSLKGYLGFYDGFSAA 79
            :||.||:.......|||:.||.:|||.|.          |.:|..:.||...:|....|.|.:.|
  Rat    11 YGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFREIRYRGMLHALMRIGREEGLRALYSGIAPA 75

  Fly    80 ILRQMTSTNIHFIVYDTGKKM--EYVDRDSYLGKIILGCVAGACGSAFGIPTDLINVRMQTDMKE 142
            :|||.:...|....|.:.|::  |..:.::.|..::.|.::|...||...|||::.:|||.....
  Rat    76 MLRQASYGTIKIGTYQSLKRLAVERPEDETLLINVVCGILSGVISSAIANPTDVLKIRMQAQNSA 140

  Fly   143 PPYKRRNYKHVFDGL----IRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNIS 203
                      |..|:    |.|.::||.:.|:||.|:...::::....::..|||.|..:..:..
  Rat   141 ----------VQGGMIGNFISIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGL 195

  Fly   204 VNDGLPLHFLTSLGTSIISSAITHPLDVVRTIMMNSR----------PGEFRTVFQASVHMMRFG 258
            :.|.:..|||:|....::.:..::|:|||||.|||.|          .|....:.|.   ....|
  Rat   196 MGDTVSTHFLSSFTCGLVGALASNPVDVVRTRMMNQRDLRDGRCSGYKGTLDCLLQT---WKNEG 257

  Fly   259 VMGPYRGFVPTIVRKAPATTLLFVLYEQLR 288
            ....|:||.|..:|..|...:.|:.||||:
  Rat   258 FFALYKGFWPNWLRLGPWNIIFFLTYEQLK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 81/287 (28%)
Mito_carr 26..100 CDD:278578 27/83 (33%)
Mito_carr 104..201 CDD:278578 25/100 (25%)
Mito_carr 211..292 CDD:278578 28/88 (32%)
Slc25a30NP_001013205.1 Solcar 1 7..96 27/84 (32%)
PTZ00169 9..289 CDD:240302 82/290 (28%)
Solcar 2 104..189 25/94 (27%)
Solcar 3 198..289 29/93 (31%)
Mito_carr 199..289 CDD:395101 28/92 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.