DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and Dic3

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster


Alignment Length:278 Identity:124/278 - (44%)
Similarity:168/278 - (60%) Gaps:10/278 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LPRWWFGGFASMCVAFAVA---PIDIVKTHMQIQRQ-KRSILGTV-KRIHSLKGYLGFYDGFSAA 79
            ||||||||   :|.|.||.   |||::|..:|.|.| .|..:|.: |.||...|.||||:|.||:
  Fly     9 LPRWWFGG---VCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEILKGIHERSGILGFYNGISAS 70

  Fly    80 ILRQMTSTNIHFIVYDTGKKMEYVDRDSYLGKIILGCVAGACGSAFGIPTDLINVRMQTDMKEPP 144
            ..||:|.|...|.:|:.||  :|||......|:.|...||..|...|:|.|::.||:|.|:|.|.
  Fly    71 WFRQLTYTTTRFALYEAGK--DYVDTQKVSSKMALATFAGIVGGIVGVPGDVVTVRLQNDVKLPE 133

  Fly   145 YKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISVNDGLP 209
            .||||||||||||.||.||||..:|::|...||.::.|.|....|.||.:|..::......:|:|
  Fly   134 EKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLKIATGAGEGVP 198

  Fly   210 LHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTVFQASVHMMRFGVMGPYRGFVPTIVRKA 274
            |||.||.....|:..||.||||::|..||::||||..:..|.:...:.|.:..|:||:|.::|.:
  Fly   199 LHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGEFSGIGGAFLSTAKQGPLAFYKGFIPALIRVS 263

  Fly   275 PATTLLFVLYEQLRLHFG 292
            |.|.:.||||||.|:.||
  Fly   264 PNTIITFVLYEQARMRFG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 115/266 (43%)
Mito_carr 26..100 CDD:278578 34/78 (44%)
Mito_carr 104..201 CDD:278578 43/96 (45%)
Mito_carr 211..292 CDD:278578 34/80 (43%)
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 113/264 (43%)
Mito_carr 15..91 CDD:278578 34/80 (43%)
Mito_carr 93..187 CDD:278578 43/93 (46%)
Mito_carr 200..281 CDD:278578 34/80 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468931
Domainoid 1 1.000 84 1.000 Domainoid score I1910
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I828
Isobase 1 0.950 - 0 Normalized mean entropy S759
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 1 1.000 - - FOG0002037
OrthoInspector 1 1.000 - - otm46877
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.850

Return to query results.
Submit another query.