DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and MME1

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster


Alignment Length:288 Identity:70/288 - (24%)
Similarity:125/288 - (43%) Gaps:38/288 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GGFASMCVAFAVAPIDIVKTHMQIQ--------RQKRSILGTVKRIHSLKGYLGFYDGFSAAILR 82
            ||...||......|:|.:|..:|..        .:.:.::....|....:|:.|||.|.||.::.
  Fly    21 GGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFYRGISAPLVG 85

  Fly    83 QMTSTNIHFIVYDTGKKMEYVD---RDSYLGKIILGCVAGACGSAFGIPTDLINVRMQTD-MKEP 143
            ......:.|.||..||::...|   |.:|......|.:||.|.:...:|||.|.|.:||. :...
  Fly    86 VTPIYAVDFAVYAAGKRLFQTDDHIRLTYPQIFAAGALAGVCSALVTVPTDRIKVLLQTQTVSNG 150

  Fly   144 PYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISVNDGL 208
            |..   |....|...::.::.|.::|:||....:.:.| .|......|:.::...||..:.....
  Fly   151 PLL---YNGTIDTAAKLYRQGGIRSLFKGTCACILRDS-PTGFYFVTYEFLQELARKKSANGKIS 211

  Fly   209 PLHFLTSLGTS-IISSAITHPLDVVRTIMMNSRPGEF----RTVFQASVHMMRFGVMGP---YRG 265
            ....:.|.||: |:...:..|.||:::.:.::..|.:    |:||:   ::|  ...||   :||
  Fly   212 TTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGTYKHGIRSVFR---NLM--ATEGPKALFRG 271

  Fly   266 FVPTIVRKAPATTLLFVLYEQLRLHFGI 293
            .:|.::|..|:|..:|         ||:
  Fly   272 ILPILLRAFPSTAAVF---------FGV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 68/281 (24%)
Mito_carr 26..100 CDD:278578 21/81 (26%)
Mito_carr 104..201 CDD:278578 25/100 (25%)
Mito_carr 211..292 CDD:278578 21/88 (24%)
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 21/85 (25%)
Mito_carr 111..205 CDD:278578 25/97 (26%)
Mito_carr 208..297 CDD:278578 23/97 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441728
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.