DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and Ucp4A

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster


Alignment Length:292 Identity:76/292 - (26%)
Similarity:131/292 - (44%) Gaps:33/292 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ASMCVAFAVAPIDIVKTHMQIQ------------RQKRSILGTVKRIHSLKGYLGFYDGFSAAIL 81
            |:.....|..|:|:.||.:|||            .|.|.::.|...|...:|.|..:.|.:.|:.
  Fly    50 AASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQGVTPALY 114

  Fly    82 RQMTSTNIHFIVYDTGKKMEYVDRDSYLGKI----ILGCVAGACGSAFGIPTDLINVRMQTD--- 139
            |.:..:.:....||..:| |:....:....:    :.|..|||.......|.||:.|::|.:   
  Fly   115 RHVVYSGVRICSYDLMRK-EFTQNGTQALPVWKSALCGVTAGAVAQWLASPADLVKVQIQMEGRR 178

  Fly   140 --MKEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNI 202
              |.||| :..:..|.|.   :|.:..|.|.|:||....|.:::|.....:..||.||..:...:
  Fly   179 RLMGEPP-RVHSAGHAFR---QIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYDTIKHLIMNRL 239

  Fly   203 SVNDGLPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGE--FRTVFQASVHMMR-----FGVM 260
            .:.|...:|.|.|:....:::.:..|.|||:|.:||....|  ...:::.||..:|     .|.:
  Fly   240 QMPDCHTVHVLASVCAGFVAAIMGTPADVVKTRIMNQPTDENGRGLLYRGSVDCLRQTVSKEGFV 304

  Fly   261 GPYRGFVPTIVRKAPATTLLFVLYEQLRLHFG 292
            ..|:||:|..:|.||.:...::.:||:|...|
  Fly   305 ALYKGFLPCWIRMAPWSLTFWLSFEQIRKMIG 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 74/286 (26%)
Mito_carr 26..100 CDD:278578 20/82 (24%)
Mito_carr 104..201 CDD:278578 27/105 (26%)
Mito_carr 211..292 CDD:278578 25/87 (29%)
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 75/289 (26%)
Mito_carr 39..138 CDD:278578 22/88 (25%)
Mito_carr 142..239 CDD:278578 27/100 (27%)
Mito_carr 248..336 CDD:278578 25/87 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441654
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.