DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic4 and sesB

DIOPT Version :9

Sequence 1:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster


Alignment Length:287 Identity:65/287 - (22%)
Similarity:127/287 - (44%) Gaps:31/287 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GGFASMCVAFAVAPIDIVKTHMQIQ---------RQKRSILGTVKRIHSLKGYLGFYDGFSAAIL 81
            ||.::.....|||||:.||..:|:|         :|.:.::....||...:|:..|:.|..|.::
  Fly    30 GGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRGNLANVI 94

  Fly    82 RQMTSTNIHFIVYDTGKK--MEYVDRDS-----YLGKIILGCVAGACGSAFGIPTDLINVRMQTD 139
            |...:..::|...|..|:  :..||:::     :.|.:..|..|||....|..|.|....|:..|
  Fly    95 RYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAAD 159

  Fly   140 MKEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISV 204
            ..:.  .:|.:..:.:.|.:|.|.:|...||:|..|:|....:...:...|||    ..|..:..
  Fly   160 TGKG--GQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYD----TARGMLPD 218

  Fly   205 NDGLPLHFLTSLG--TSIISSAITHPLDVV-RTIMMNSRPGEFRTVFQASVH-----MMRFGVMG 261
            ....|::...::.  .:.::..:::|.|.| |.:||.|.......:::.::|     ..:.|...
  Fly   219 PKNTPIYISWAIAQVVTTVAGIVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQEGTGA 283

  Fly   262 PYRGFVPTIVRKAPATTLLFVLYEQLR 288
            .::|....|:|......:| |||::::
  Fly   284 FFKGAFSNILRGTGGAFVL-VLYDEIK 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 65/285 (23%)
Mito_carr 26..100 CDD:278578 22/84 (26%)
Mito_carr 104..201 CDD:278578 25/101 (25%)
Mito_carr 211..292 CDD:278578 16/86 (19%)
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 22/85 (26%)
PTZ00169 23..312 CDD:240302 65/287 (23%)
Mito_carr 124..220 CDD:278578 24/101 (24%)
Mito_carr 223..312 CDD:278578 17/88 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441939
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.